KEGG   Miniopterus natalensis: 107526031Help
Entry
107526031         CDS       T05883                                 

Gene name
HK1
Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
mna  Miniopterus natalensis
Pathway
mna00010  Glycolysis / Gluconeogenesis
mna00051  Fructose and mannose metabolism
mna00052  Galactose metabolism
mna00500  Starch and sucrose metabolism
mna00520  Amino sugar and nucleotide sugar metabolism
mna00524  Neomycin, kanamycin and gentamicin biosynthesis
mna01100  Metabolic pathways
mna01200  Carbon metabolism
mna04066  HIF-1 signaling pathway
mna04910  Insulin signaling pathway
mna04930  Type II diabetes mellitus
mna04973  Carbohydrate digestion and absorption
mna05230  Central carbon metabolism in cancer
Module
mna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mna_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107526031 (HK1)
   00051 Fructose and mannose metabolism
    107526031 (HK1)
   00052 Galactose metabolism
    107526031 (HK1)
   00500 Starch and sucrose metabolism
    107526031 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    107526031 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    107526031 (HK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    107526031 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107526031 (HK1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    107526031 (HK1)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    107526031 (HK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107526031 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107526031 (HK1)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     107526031 (HK1)
Membrane trafficking [BR:mna04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    107526031 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 107526031
NCBI-ProteinID: XP_016053845
LinkDB All DBs
Position
Unknown
AA seq 917 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYSMRLSDETLVDIMTRFKKEMRNGLSRDFNPTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEMYDTPENIMH
GSGSQLFDHVAECLGDFMEKKKIKDKNLPVGLTFSFPCRQSRIDEGVLITWTKRFKASGV
EGVDVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQHCEVGLIIGTGTNACYME
ELRHIELVEGDEGRMCINTEWGAFGDDGALEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YLGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTLDVSAIERNKEGLNNAKEILTRLG
VEPSDDDCVAVQHVCTIVSFRSANLVAATLSAILTRLRDNKGVPRLRTTVGVDGSLYKTH
PQYSRRFHKTLRRLVPDSDVRFLLSESGSAKGAAMVTAVAHRLAEQHRQIEETLSHFRLT
KEMLLEVKKRMRTEMDLGLRKATNNKAVVKMLPSFVRSTPDGTEHGDFLALDLGGTNFRV
LLVKIRSGKKRTVEMHNKIYAIPIEIMQGTGEELFDHIVTCISDFLDYMGIKGPRMPLGF
TFSFPCKQTSLDAGILITWTKGFKATDCVGHDVATLLRDAVKRREEFDLDVVAVVNDTVG
TMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMLEGNEGRMCINMEWGAFGDNGCLDD
IRTNYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISEPLKTRG
IFQTKYLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSKRAAQLCGAGMAA
VVDKIRENRGLDHLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDGSGKG
AALITAVGVRLRGEASS
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgcgcagctcctggcctattacttcacggagctgaaagatgaccaagtcaaa
aagattgacaagtatctctattccatgcggctctccgatgaaactctggtagatatcatg
actcgtttcaagaaggagatgaggaatggtctttcccgggattttaatccaacagccaca
gtcaagatgttgccaacgtttgtaaggtccattcctgatggttcagaaaagggagatttc
attgccctggatcttggcgggtcttcctttcgaattctgcgggtgcaagtgaatcatgag
aaaaaccagaatgttcacatggagtctgagatgtatgacaccccggagaacatcatgcat
ggcagcggaagccagcttttcgatcatgtggctgagtgcctgggagacttcatggagaaa
aaaaaaatcaaggacaagaatctgcccgtggggctcacgttttctttcccttgccggcag
tcccggatagacgagggcgttctgatcacctggacaaagcgatttaaagcgagcggagtg
gagggagtggatgtggtgaagctgcttaacaaagccatcaaaaagcgcggggattatgat
gccaacatcgtggccgtggtgaatgacacggtggggaccatgatgacttgtggttatgac
gaccagcattgtgaagttggcctcatcattggcactggcaccaacgcgtgctacatggag
gaactgaggcacattgaactggtggaaggtgacgaggggcggatgtgcatcaacactgag
tggggggccttcggggacgatggagccctggaagacatccgcacggagtttgaccgcgag
atagaccggggatctcttaaccctggaaaacagctgtttgagaagatggtcagtggcatg
tacctgggggagctggttcgactgatcctggtcaagatggccaaggagggccttttattt
gaagggcggatcaccccagagctgctcaccagaggaaagtttaacacccttgatgtgtca
gccattgaaaggaataaggaaggcctcaacaatgccaaagaaattctgacccgcctggga
gtggagccctccgatgacgactgtgttgcggtccagcacgtgtgcaccatcgtctcattc
cgctctgccaacctggtggctgcaacgctgagtgccatcttgactcgccttcgcgataac
aagggcgtccccaggctgcggaccacggttggtgtcgacgggtctctttacaagacgcac
ccacagtattcccgacgtttccacaagacgctgaggcgcttggtgcccgactccgatgtg
cgtttcctcctctcggagagtggcagtgccaagggcgcagccatggtgaccgcggtggcc
caccgcctggccgagcagcaccggcagatagaggagaccctgtcccacttccgcctcacc
aaggagatgctgctggaggtcaagaagaggatgcggacggagatggacctggggctgagg
aaggcgaccaacaacaaggctgtggtcaagatgctgccctccttcgtcaggagcactccc
gacgggactgagcatggtgacttcttggccctggatcttgggggaacaaatttccgagtt
ctgctggtgaaaatccgtagtgggaaaaagagaacggtggaaatgcacaacaagatctac
gccattcccattgaaattatgcagggcaccggggaagagctgtttgaccacatcgtgacc
tgcatctccgacttcctggactacatggggatcaaaggccccagaatgcctctgggcttc
acattttcgtttccctgcaagcagacgagcttggatgcgggaatcttgatcacatggaca
aaggggtttaaggcaaccgactgtgtggggcacgacgtagccactttactaagggatgcg
gtaaaaaggagagaggaatttgatctggatgtggtggctgtggtcaatgacacggtgggc
accatgatgacctgtgcttatgaggagcccacctgtgaggttggactcatcgtagggact
ggcagcaacgcctgctacatggaagagatgaagaacgtggagatgctggaggggaatgag
ggccggatgtgtatcaacatggagtggggtgcttttggggacaacgggtgtctggatgat
atcagaacaaactacgacagactggtggatgaatattctctaaacgctgggaaacaaagg
tatgagaagatgatcagtggcatgtacttgggtgaaattgttcgcaacatcttgattgac
ttcaccaagaagggattcctcttccgaggacagatctctgagccgctgaagactcggggc
atctttcagaccaagtatctctctcagattgagagtgaccggttagcgctgctccaggtc
cgggccatcctccagcagctgggcctgaatagcacctgcgacgacagtatcctcgtgaag
accgtgtgcggggtggtgtcgaagagggccgcgcagctgtgcggtgcaggcatggctgcc
gtggtggataagatccgagagaacagagggctggaccatctcaacgtgaccgtgggggtg
gatggaacactctacaagctccatccgcacttctccagaatcatgcaccagaccgtgaag
gaactgtcaccaaagtgtaacgtgtccttcctcctgtccgaagacggtagtggcaagggg
gctgccctcatcacggcagtgggcgtccggctccggggagaagcgagcagctaa

DBGET integrated database retrieval system