KEGG   Miniopterus natalensis: 107526113
Entry
107526113         CDS       T05883                                 

Gene name
SSTR1
Definition
(RefSeq) somatostatin receptor type 1
  KO
K04217  somatostatin receptor 1
Organism
mna  Miniopterus natalensis
Pathway
mna04024  cAMP signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107526113 (SSTR1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107526113 (SSTR1)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    107526113 (SSTR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107526113 (SSTR1)
G protein-coupled receptors [BR:mna04030]
 Rhodopsin family
  Peptide
   Somatostatin
    107526113 (SSTR1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv 7tm_4 T2SSM Piezo_RRas_bdg
Other DBs
NCBI-GeneID: 107526113
NCBI-ProteinID: XP_016053945
LinkDB
Position
Unknown
AA seq 390 aa
MFPNGTASSPSSPSPSPGSCGEGGGSRGPGAGAADGMEDPGRNASQNGTLSEGQGSAILI
SFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLLR
HWPFGALLCRLVLSVDAVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGV
WVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQRWLVGFVLYTFLMGFLLPVGAICL
CYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQDD
ATVSQLSVILGYANSCANPILYGFLSDNFKRSFQRILCLSWMDNAAEEPVDYYATALKSR
AYSVEDFQPDNLESGGVFRNGTCTSRITTL
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgttccccaatggcaccgcctcctctccctcctctcctagccccagcccgggcagctgt
ggcgaaggcggcggcagcaggggccccggggccggagctgcggacggcatggaggacccc
gggcggaatgcgtcccagaacgggaccttgagcgaaggccagggcagcgccatcctcatc
tctttcatctactcggtggtgtgcctggtggggctgtgcgggaactccatggtcatctac
gtgatcctgcgctacgccaagatgaagacggccaccaacatctacatcctcaacctggcc
atcgccgacgagctgctcatgctcagcgtgcccttcctggtcacctccacgctgcttcgc
cactggcccttcggcgcgctgctctgccgcctggtgctcagcgtggacgcggtgaacatg
ttcaccagcatctactgtctgactgtgctcagcgtggaccgctacgtggccgtggtgcac
cccatcaaggccgcgcgctaccgccggcccaccgtggccaaggtggtgaacttgggggtg
tgggtgctgtcgctgctggtcatcctgcccatcgtggtcttctcgcgcacggcggccaac
agcgacggcactgtggcctgcaacatgctcatgcccgagcccgcccagcgctggctggtg
ggcttcgtgctgtacacgttcctcatgggcttcctgctgcccgtcggggccatctgcctg
tgctacgtgctcatcatcgccaagatgcgcatggtagccctcaaggccggctggcagcag
cgcaagcgctcggagcggaagatcaccctgatggtgatgatggtggtcatggtgttcgtc
atctgctggatgcccttctacgtggtgcagctggtgaatgtgttcgcagagcaggacgac
gccacggtgagccagctgtcggtcatcctcggctacgccaacagctgcgccaaccccatc
ctctacggcttcctctcggacaacttcaagcgctctttccagcgcatcctgtgcctcagc
tggatggacaacgcggcggaggagccggtcgactactacgccaccgccctcaagagccgc
gcctacagcgtggaggacttccagcccgacaacctggagtccggcggcgtcttccgtaac
ggcacctgcacgtcccggatcacaacgctctga

KEGG   Miniopterus natalensis: 107528392
Entry
107528392         CDS       T05883                                 

Gene name
SSTR2
Definition
(RefSeq) somatostatin receptor type 2
  KO
K04218  somatostatin receptor 2
Organism
mna  Miniopterus natalensis
Pathway
mna04024  cAMP signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04935  Growth hormone synthesis, secretion and action
mna04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107528392 (SSTR2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107528392 (SSTR2)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    107528392 (SSTR2)
  09154 Digestive system
   04971 Gastric acid secretion
    107528392 (SSTR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107528392 (SSTR2)
G protein-coupled receptors [BR:mna04030]
 Rhodopsin family
  Peptide
   Somatostatin
    107528392 (SSTR2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv
Other DBs
NCBI-GeneID: 107528392
NCBI-ProteinID: XP_016056956
LinkDB
Position
Unknown
AA seq 369 aa
METAYELLNCSQPLLSAPFELNGSVAVANISNQTEPYYDLTSNVVLTFIYFVVCIIGLCG
NTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMT
VDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPWTAKMINVAVWGVSLLVILPIMIY
AGLRSNQWGRSSCTINWPGESGAWYTGFIIYAFILGFLVPLTIICLCYLFIIIKVKSSGI
RVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSVAINPTPALKGMFDFVVIL
TYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTL
LNGDLQTSI
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggagacggcgtatgagctactcaattgcagccaaccattgctttccgctccattcgaa
ctcaacggctcagtggcagtggccaacatctcaaaccagacagagccatactatgacctg
accagcaatgtggtcctcacgttcatctattttgtggtctgcatcattgggttgtgcggc
aacacgcttgtcatttatgtcatcctccgctatgccaagatgaagaccatcaccaacatt
tacatcctcaacctggccatcgcagacgagctcttcatgctgggtctgcccttcttggcc
atgcaggtggctctggtccactggccctttggcaaggccatttgccgggtggtcatgact
gtggatggcatcaatcagtttaccagcattttctgcttgacagtcatgagcattgacaga
tacctggctgtggtccaccccatcaagtcggccaagtggaggagaccctggacagccaag
atgatcaacgtggctgtgtggggagtctctctgctggtcatcttgcctatcatgatctat
gcggggcttcgcagcaaccagtggggcagaagcagctgcaccattaactggccgggtgaa
tctggggcatggtacacaggcttcatcatctacgccttcatcttggggttcctggtgccc
ctcaccatcatttgtctctgctacctgttcattatcatcaaggtgaagtcctctggaatc
cgagtgggttcctccaagaggaaaaagtcagagaagaaggtcacccggatggtgtccata
gtggtggccgtcttcattttctgctggctccctttctacatattcaatgtctcctcggtc
tctgtggccatcaatcccactccagccctcaaaggcatgttcgactttgttgtgatcctc
acctacgctaacagctgtgccaatcccatcctgtatgcctttctgtccgacaacttcaag
aagagcttccagaatgtcctctgcttggtcaaggtgagcggcacagatgatggggaacgg
agtgacagtaagcaggacaaatcccgactgaacgagaccacagagacccagagaaccctc
ctcaatggagacctccagaccagtatctga

KEGG   Miniopterus natalensis: 107533362
Entry
107533362         CDS       T05883                                 

Gene name
SSTR5
Definition
(RefSeq) somatostatin receptor type 5
  KO
K04221  somatostatin receptor 5
Organism
mna  Miniopterus natalensis
Pathway
mna04024  cAMP signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107533362 (SSTR5)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107533362 (SSTR5)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    107533362 (SSTR5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107533362 (SSTR5)
G protein-coupled receptors [BR:mna04030]
 Rhodopsin family
  Peptide
   Somatostatin
    107533362 (SSTR5)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv 7TM_GPCR_Srw
Other DBs
NCBI-GeneID: 107533362
NCBI-ProteinID: XP_016063499
LinkDB
Position
Unknown
AA seq 365 aa
MEPLFPTSKSATWNTSSAATGGGGGNGTMAGPAPLPGARAVVVPVLYLLVCAAGLGGNAL
VIYVVLRHAKMKTVTNIYILNLAVADVLLMLGLPFLATQNAVSYWPFGPVLCRLVMTLDG
INQFTSIFCLTVMSVDRYLAVVHPIRSTRWRRPRVAKLASAAVWAFSLLMSLPLVVFADI
QEGWDTCNLSWPEPVGLWGAVFIIYTSVLGFFGPLLVICLCYLLIVVKVKASGVRVGSTR
RRSERKVTRMVVVVVLVFVGCWLPFFIVNIVNLAIVLPEEPAAAGVYFFVVILSYANSCA
NPVLYGFLSDNFRQSFRKVLCFRKGYGTEDADATEPQPDKSSRLQEATLAACSSEANGLM
QTSRL
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggagcctctgttccccacctccaaatcagccacctggaatacctcctcagcggccacc
ggcggaggcggcgggaacgggacgatggcagggccggcacccttgccgggggcccgagcg
gttgtggtgccggtgctctacctgctggtgtgtgcggcggggctgggcggcaatgcgctg
gtcatctacgtggtgctgcgccacgccaagatgaagactgtcaccaacatctacatcctc
aacctggcggtggccgacgtgctcctcatgctggggctgcccttcctggccacacagaat
gccgtctcctactggcccttcggccccgtgctgtgccgcctcgtcatgacgctggacggc
atcaaccagttcaccagcatcttctgcctgacggtcatgagcgtggaccgctacctggcc
gtggtccaccccatccgctccacgcgctggcgccgcccgcgggtggccaagctggccagc
gccgccgtctgggccttctcgctgctcatgtctctgccgctggtggtcttcgcggacatc
caggagggctgggacacctgcaacctcagctggcccgagcccgtgggcctgtggggcgct
gtcttcatcatctacacgtccgtgctgggcttcttcgggcccctgctggtcatctgcctg
tgctacctgctgatcgtggtgaaggtgaaggcgtcgggggtgcgcgtgggctccacacgg
cggcgctcggagcgcaaggtgacgcgcatggtggtggtggtggtgctggtgttcgtgggc
tgctggctgcctttcttcatcgtcaacatcgtcaacctcgccatcgtcctgcccgaggag
cccgctgccgcgggggtctacttcttcgtggtcatcctgtcctacgccaacagctgtgcc
aaccctgtgctctacggcttcctctctgacaacttccgccagagcttccggaaggttctg
tgcttccgaaagggctatggcaccgaggacgcggatgccacagagccgcagcctgacaag
agcagccgtctccaggaggccacgctggccgcatgcagctcagaggccaacgggctcatg
cagaccagtaggttgtga

KEGG   Miniopterus natalensis: 107545271
Entry
107545271         CDS       T05883                                 

Gene name
SSTR3
Definition
(RefSeq) somatostatin receptor type 3
  KO
K04219  somatostatin receptor 3
Organism
mna  Miniopterus natalensis
Pathway
mna04080  Neuroactive ligand-receptor interaction
mna04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107545271 (SSTR3)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    107545271 (SSTR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107545271 (SSTR3)
G protein-coupled receptors [BR:mna04030]
 Rhodopsin family
  Peptide
   Somatostatin
    107545271 (SSTR3)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv 7TM_GPCR_Srw Serpentine_r_xa Rab5ip
Other DBs
NCBI-GeneID: 107545271
NCBI-ProteinID: XP_016078801
LinkDB
Position
Unknown
AA seq 425 aa
MNTLGYPSSAPTTSEPGNTSSAWLLDATVGNVSAAPSAAGLAVSGVLIPLVYLVVCVVGL
LGNSLVIYVVLRHTASPSVTNVYILNLALADELFMLGLPFLAAQNALSYWPFGSLMCRLV
MAVDGINQFTSIFCLTVMSVDRYLAVVHPTRSARWRTAAVARTVSAAVWVASAVVVLPVV
VFSGVPRGMSTCHMQWPEPAAAWRAGFIIYTAALGFFGPLLVICLCYLLIVVKMRSAGRR
VWAPSCQRRRRSERRVTRMVVAVVALFVLCWMPFYVLNIINVVCPLPEEPAFFGLYFLVV
ALPYANSCANPILYGFLSYRFKQGFRRVLLRPSRRVRSQEPPAGPLEKTEEEEGEEEGDG
EEGGKEGAGQQGGEKEANGRVSQITWPGTSRQERPPSHVAGKEQQFLPQEPSAGAKSDTL
HMSSL
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgaacaccctcggctatccctcatcggcgcccacgacctcggaacccgggaacacctcc
tcggcctggctgctggatgccactgtgggaaacgtgtcggcggccccgagcgcagccggg
ctggccgtcagcggcgtgctaatcccgctggtctacctggtggtgtgcgtggtgggcctg
ctgggcaactcactggtgatctacgtggtcctgcggcacacggccagcccgtcggttacc
aacgtctacatcctgaacctggcgctggccgatgagctcttcatgctggggctgcccttc
ctggctgcccagaacgccctgtcctactggcccttcggctccctcatgtgccgcctggtc
atggccgtggacggcatcaaccagttcaccagcatcttctgcctcacggtcatgagcgtg
gaccgctacctggccgtggtgcatcccacgcgctcggcccgctggcgcaccgccgccgtg
gcccgcaccgtcagcgcggccgtctgggtggcctcggccgtggtggtgctgcccgtggtg
gtcttctcgggtgtgccgcggggcatgagcacctgccacatgcagtggcccgagccagcg
gcggcctggcgagcgggcttcatcatctacaccgccgcgctgggtttctttgggccgctt
ctggtcatctgcctctgctacctgctcatagtggtcaagatgcgctcagcagggcggcgg
gtgtgggcaccctcgtgccagcgtcgacggcgctccgagcgcagagtcacccgcatggtg
gtggccgtggtggcactctttgtcctctgctggatgcccttctacgtgctcaatatcatc
aacgtggtgtgcccgctgcccgaggagcccgccttcttcggcctctatttcctggtggtg
gcgctgccctatgccaacagctgcgccaaccccatcctgtatggcttcctctcctaccgc
ttcaagcagggcttccgcagggtcctgctccggccttcccgccgcgtgcgaagccaggag
cccccggccgggcctctggagaagacagaggaggaggagggagaggaggaaggggatggt
gaagagggtgggaaggagggggcggggcagcaggggggcgagaaggaggcaaatggccgg
gtcagccagatcacatggcctggcaccagcaggcaggagaggccgcccagccatgtggct
ggcaaggaacagcagttcctaccccaagagccctcagctggggcgaagtcggacacgctg
cacatgagctctctgtag

DBGET integrated database retrieval system