Miniopterus natalensis: 107526117 Help Entry 107526117         CDS       T05883                                  Gene name NFKBIA Definition (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism mna  Miniopterus natalensis Pathway mna04024   cAMP signaling pathway mna04062   Chemokine signaling pathway mna04064   NF-kappa B signaling pathway mna04210   Apoptosis mna04380   Osteoclast differentiation mna04620   Toll-like receptor signaling pathway mna04621   NOD-like receptor signaling pathway mna04622   RIG-I-like receptor signaling pathway mna04623   Cytosolic DNA-sensing pathway mna04625   C-type lectin receptor signaling pathway mna04657   IL-17 signaling pathway mna04658   Th1 and Th2 cell differentiation mna04659   Th17 cell differentiation mna04660   T cell receptor signaling pathway mna04662   B cell receptor signaling pathway mna04668   TNF signaling pathway mna04722   Neurotrophin signaling pathway mna04920   Adipocytokine signaling pathway mna04926   Relaxin signaling pathway mna04931   Insulin resistance mna05132   Salmonella infection mna05134   Legionellosis mna05135   Yersinia infection mna05140   Leishmaniasis mna05142   Chagas disease mna05145   Toxoplasmosis mna05160   Hepatitis C mna05161   Hepatitis B mna05162   Measles mna05163   Human cytomegalovirus infection mna05164   Influenza A mna05166   Human T-cell leukemia virus 1 infection mna05167   Kaposi sarcoma-associated herpesvirus infection mna05168   Herpes simplex virus 1 infection mna05169   Epstein-Barr virus infection mna05170   Human immunodeficiency virus 1 infection mna05171   Coronavirus disease - COVID-19 mna05200   Pathways in cancer mna05203   Viral carcinogenesis mna05215   Prostate cancer mna05220   Chronic myeloid leukemia mna05222   Small cell lung cancer mna05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:mna00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     107526117 (NFKBIA)    04668 TNF signaling pathway     107526117 (NFKBIA)    04024 cAMP signaling pathway     107526117 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     107526117 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     107526117 (NFKBIA)    04621 NOD-like receptor signaling pathway     107526117 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     107526117 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     107526117 (NFKBIA)    04625 C-type lectin receptor signaling pathway     107526117 (NFKBIA)    04660 T cell receptor signaling pathway     107526117 (NFKBIA)    04658 Th1 and Th2 cell differentiation     107526117 (NFKBIA)    04659 Th17 cell differentiation     107526117 (NFKBIA)    04657 IL-17 signaling pathway     107526117 (NFKBIA)    04662 B cell receptor signaling pathway     107526117 (NFKBIA)    04062 Chemokine signaling pathway     107526117 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     107526117 (NFKBIA)    04926 Relaxin signaling pathway     107526117 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     107526117 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     107526117 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     107526117 (NFKBIA)    05203 Viral carcinogenesis     107526117 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     107526117 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     107526117 (NFKBIA)    05215 Prostate cancer     107526117 (NFKBIA)    05222 Small cell lung cancer     107526117 (NFKBIA)   09167 Endocrine and metabolic disease    04931 Insulin resistance     107526117 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     107526117 (NFKBIA)    05135 Yersinia infection     107526117 (NFKBIA)    05134 Legionellosis     107526117 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     107526117 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     107526117 (NFKBIA)    05161 Hepatitis B     107526117 (NFKBIA)    05160 Hepatitis C     107526117 (NFKBIA)    05171 Coronavirus disease - COVID-19     107526117 (NFKBIA)    05164 Influenza A     107526117 (NFKBIA)    05162 Measles     107526117 (NFKBIA)    05168 Herpes simplex virus 1 infection     107526117 (NFKBIA)    05163 Human cytomegalovirus infection     107526117 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     107526117 (NFKBIA)    05169 Epstein-Barr virus infection     107526117 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     107526117 (NFKBIA)    05140 Leishmaniasis     107526117 (NFKBIA)    05142 Chagas disease     107526117 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mna03000]     107526117 (NFKBIA)    04131 Membrane trafficking [BR:mna04131]     107526117 (NFKBIA) Transcription factors [BR:mna03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     107526117 (NFKBIA) Membrane trafficking [BR:mna04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     107526117 (NFKBIA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ank Ank_2 Ank_3 Ank_5 Ank_4 Motif Other DBs NCBI-GeneID:  107526117 NCBI-ProteinID:  XP_016053947 LinkDB All DBs Position Unknown AA seq 314 aa AA seqDB search MFHPAEHAQDWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAP RSSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCGTQHLHSILQATN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDEL PYDDCVFGGQRLML NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgttccaccccgccgagcacgcccaggactgggccatggagggcccccgggacgggctc aagaaggagcggctgctggacgaccgccacgacagcggcctggactccatgaaggacgag gagtacgagcagatggtgaaggagctgcgggagatccgcctggagccgcaggaggcgccg cgcagctccgagccctggaagcagcagctcaccgaggacggagactcgttcctgcacttg gctatcatccatgaagagaaggcgctgactatggaagtggtccgccaagtgaagggtgac ctggcttttctgaatttccagaacaaccttcagcagactccgctccacttggctgtgatc accaaccagccagaaattgctgaggcacttctggaagctggctgtgatcctgagctcaga gactttcgaggaaatacccccctacaccttgcctgtgagcagggctgcctggccagtgtg ggagtcctgactcagagctgtgggacccagcacctccactccatcctgcaggccaccaac tacaatggccacacatgtctgcacttagcctctatccatggctacctgggcatcgtggag cttttggtgtccttgggtgctgatgtgaatgctcaggagccctgtaatggccgaactgcc cttcatcttgcagtggacctgcagaatcctgacctggtgtctctcctgttgaagtgtgga gctgatgtcaacagagtcacctaccagggctactccccataccagctcacctggggccgc ccaagcacccggatacagcagcagctgggccagctgaccctagaaaaccttcagatgctg ccagagagtgaggatgaggagagctatgatacagagtcagagttcacagaggatgagctg ccttatgatgactgtgtgtttggaggccagcgtctgatgttatga

DBGET integrated database retrieval system