KEGG   Miniopterus natalensis: 107526117
Entry
107526117         CDS       T05883                                 

Gene name
NFKBIA
Definition
(RefSeq) NF-kappa-B inhibitor alpha
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
mna  Miniopterus natalensis
Pathway
mna04024  cAMP signaling pathway
mna04062  Chemokine signaling pathway
mna04064  NF-kappa B signaling pathway
mna04210  Apoptosis
mna04380  Osteoclast differentiation
mna04620  Toll-like receptor signaling pathway
mna04621  NOD-like receptor signaling pathway
mna04622  RIG-I-like receptor signaling pathway
mna04623  Cytosolic DNA-sensing pathway
mna04625  C-type lectin receptor signaling pathway
mna04657  IL-17 signaling pathway
mna04658  Th1 and Th2 cell differentiation
mna04659  Th17 cell differentiation
mna04660  T cell receptor signaling pathway
mna04662  B cell receptor signaling pathway
mna04668  TNF signaling pathway
mna04722  Neurotrophin signaling pathway
mna04920  Adipocytokine signaling pathway
mna04926  Relaxin signaling pathway
mna04931  Insulin resistance
mna05132  Salmonella infection
mna05134  Legionellosis
mna05135  Yersinia infection
mna05140  Leishmaniasis
mna05142  Chagas disease
mna05145  Toxoplasmosis
mna05160  Hepatitis C
mna05161  Hepatitis B
mna05162  Measles
mna05163  Human cytomegalovirus infection
mna05164  Influenza A
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05171  Coronavirus disease - COVID-19
mna05200  Pathways in cancer
mna05203  Viral carcinogenesis
mna05215  Prostate cancer
mna05220  Chronic myeloid leukemia
mna05222  Small cell lung cancer
mna05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    107526117 (NFKBIA)
   04668 TNF signaling pathway
    107526117 (NFKBIA)
   04024 cAMP signaling pathway
    107526117 (NFKBIA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107526117 (NFKBIA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107526117 (NFKBIA)
   04621 NOD-like receptor signaling pathway
    107526117 (NFKBIA)
   04622 RIG-I-like receptor signaling pathway
    107526117 (NFKBIA)
   04623 Cytosolic DNA-sensing pathway
    107526117 (NFKBIA)
   04625 C-type lectin receptor signaling pathway
    107526117 (NFKBIA)
   04660 T cell receptor signaling pathway
    107526117 (NFKBIA)
   04658 Th1 and Th2 cell differentiation
    107526117 (NFKBIA)
   04659 Th17 cell differentiation
    107526117 (NFKBIA)
   04657 IL-17 signaling pathway
    107526117 (NFKBIA)
   04662 B cell receptor signaling pathway
    107526117 (NFKBIA)
   04062 Chemokine signaling pathway
    107526117 (NFKBIA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107526117 (NFKBIA)
   04926 Relaxin signaling pathway
    107526117 (NFKBIA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107526117 (NFKBIA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107526117 (NFKBIA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107526117 (NFKBIA)
   05203 Viral carcinogenesis
    107526117 (NFKBIA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107526117 (NFKBIA)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    107526117 (NFKBIA)
   05215 Prostate cancer
    107526117 (NFKBIA)
   05222 Small cell lung cancer
    107526117 (NFKBIA)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    107526117 (NFKBIA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107526117 (NFKBIA)
   05135 Yersinia infection
    107526117 (NFKBIA)
   05134 Legionellosis
    107526117 (NFKBIA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107526117 (NFKBIA)
   05170 Human immunodeficiency virus 1 infection
    107526117 (NFKBIA)
   05161 Hepatitis B
    107526117 (NFKBIA)
   05160 Hepatitis C
    107526117 (NFKBIA)
   05171 Coronavirus disease - COVID-19
    107526117 (NFKBIA)
   05164 Influenza A
    107526117 (NFKBIA)
   05162 Measles
    107526117 (NFKBIA)
   05168 Herpes simplex virus 1 infection
    107526117 (NFKBIA)
   05163 Human cytomegalovirus infection
    107526117 (NFKBIA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107526117 (NFKBIA)
   05169 Epstein-Barr virus infection
    107526117 (NFKBIA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107526117 (NFKBIA)
   05140 Leishmaniasis
    107526117 (NFKBIA)
   05142 Chagas disease
    107526117 (NFKBIA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mna03000]
    107526117 (NFKBIA)
   04131 Membrane trafficking [BR:mna04131]
    107526117 (NFKBIA)
Transcription factors [BR:mna03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    107526117 (NFKBIA)
Membrane trafficking [BR:mna04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    107526117 (NFKBIA)
SSDB
Motif
Pfam: Ank Ank_2 Ank_3 Ank_5 Ank_4
Other DBs
NCBI-GeneID: 107526117
NCBI-ProteinID: XP_016053947
LinkDB
Position
Unknown
AA seq 314 aa
MFHPAEHAQDWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAP
RSSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVI
TNQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCGTQHLHSILQATN
YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG
ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDEL
PYDDCVFGGQRLML
NT seq 945 nt   +upstreamnt  +downstreamnt
atgttccaccccgccgagcacgcccaggactgggccatggagggcccccgggacgggctc
aagaaggagcggctgctggacgaccgccacgacagcggcctggactccatgaaggacgag
gagtacgagcagatggtgaaggagctgcgggagatccgcctggagccgcaggaggcgccg
cgcagctccgagccctggaagcagcagctcaccgaggacggagactcgttcctgcacttg
gctatcatccatgaagagaaggcgctgactatggaagtggtccgccaagtgaagggtgac
ctggcttttctgaatttccagaacaaccttcagcagactccgctccacttggctgtgatc
accaaccagccagaaattgctgaggcacttctggaagctggctgtgatcctgagctcaga
gactttcgaggaaatacccccctacaccttgcctgtgagcagggctgcctggccagtgtg
ggagtcctgactcagagctgtgggacccagcacctccactccatcctgcaggccaccaac
tacaatggccacacatgtctgcacttagcctctatccatggctacctgggcatcgtggag
cttttggtgtccttgggtgctgatgtgaatgctcaggagccctgtaatggccgaactgcc
cttcatcttgcagtggacctgcagaatcctgacctggtgtctctcctgttgaagtgtgga
gctgatgtcaacagagtcacctaccagggctactccccataccagctcacctggggccgc
ccaagcacccggatacagcagcagctgggccagctgaccctagaaaaccttcagatgctg
ccagagagtgaggatgaggagagctatgatacagagtcagagttcacagaggatgagctg
ccttatgatgactgtgtgtttggaggccagcgtctgatgttatga

DBGET integrated database retrieval system