KEGG   Miniopterus natalensis: 107526142
Entry
107526142         CDS       T05883                                 

Gene name
NCALD
Definition
(RefSeq) neurocalcin-delta
  KO
K19695  neurocalcin delta
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107526142 (NCALD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mna04990]
    107526142 (NCALD)
Domain-containing proteins not elsewhere classified [BR:mna04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   107526142 (NCALD)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EF-hand_4
Other DBs
NCBI-GeneID: 107526142
NCBI-ProteinID: XP_016053987
LinkDB
Position
Unknown
AA seq 193 aa
MGKQNSKLRPEVMQDLLESTDFTEHEIQEWYKGFLRDCPSGHLSMEEFKRIYGNFFPYGD
ASKFAEHVFRTFDANGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISKAE
MLEIVQAIYKMVSSVMKMPEDESTPEKRTEKIFRQMDTNRDGKLSLEEFIRGAKSDPSIV
RLLQCDPSSAGQF
NT seq 582 nt   +upstreamnt  +downstreamnt
atgggcaaacagaacagcaagctgcgcccggaggtcatgcaggacctgctggagagcacg
gacttcacggagcacgagatccaggagtggtacaagggcttcctgagggactgccccagt
gggcacctgtcgatggaggagttcaagagaatttacgggaacttcttcccttacggagac
gcgtccaagttcgcagagcacgtcttccgcaccttcgatgccaatggagatgggacaata
gactttagggagttcatcatcgccctgagtgtgacatcgaggggcaagctggagcagaag
ctgaagtgggccttcagcatgtacgacctggacggaaacggctacatcagcaaggcggaa
atgctggagatcgtgcaggccatctataagatggtttcctccgtgatgaaaatgcctgag
gatgagtcaaccccagagaaaagaaccgagaagatcttccgccaaatggacaccaacaga
gatggcaaactctccctggaagagttcatccgaggggccaagagcgacccgtccatagtg
cgcctcctgcagtgcgaccccagcagcgccggccagttctga

DBGET integrated database retrieval system