KEGG   Miniopterus natalensis: 107526144
Entry
107526144         CDS       T05883                                 

Gene name
RRM2B
Definition
(RefSeq) ribonucleoside-diphosphate reductase subunit M2 B isoform X1
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
mna  Miniopterus natalensis
Pathway
mna00230  Purine metabolism
mna00240  Pyrimidine metabolism
mna00480  Glutathione metabolism
mna00983  Drug metabolism - other enzymes
mna01100  Metabolic pathways
mna04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107526144 (RRM2B)
   00240 Pyrimidine metabolism
    107526144 (RRM2B)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107526144 (RRM2B)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    107526144 (RRM2B)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    107526144 (RRM2B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mna03400]
    107526144 (RRM2B)
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     107526144 (RRM2B)
DNA repair and recombination proteins [BR:mna03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    107526144 (RRM2B)
SSDB
Motif
Pfam: Ribonuc_red_sm
Other DBs
NCBI-GeneID: 107526144
NCBI-ProteinID: XP_016053993
LinkDB
Position
Unknown
AA seq 297 aa
MYKQAQASFWTAEEVDLSKDLPHWNKLKEDERYFISRILAFFAASDGIVNENLVERFSQE
VQVPEARCFYGFQILIENVHSEMYSLLIDTYIRDPKEREFLFNAIETMPYVKKKADWALQ
WIADRKSTFGERVVAFAAVEGVFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDF
ACLMFRYLVNKPSEERAREIIVNAVKIEQKFLTEALPVGLIGMNSVLMKQYIEFVADRLL
VELGFSKFFQAENPFDFMENISLEGKTNFFEKRVSEYQRFAVMAENTDNVFTLDADF
NT seq 894 nt   +upstreamnt  +downstreamnt
atgtataaacaggctcaggcatccttctggacagcagaagaggttgacttatcaaaggat
ctccctcactggaacaagcttaaagaagatgagaggtattttatctctcgcatcttagcc
ttttttgcagccagtgatggaattgtgaatgaaaatttggtggaacgatttagtcaggag
gtgcaggttccagaagctcgctgtttctatggctttcaaattctcatcgagaatgttcac
tcagagatgtacagtttgctaatagacacttacatcagagatcccaaggaaagggaattt
ttatttaatgcaattgaaacaatgccatatgttaagaagaaagcagattgggccttgcaa
tggatagcagatagaaaatctacttttggggaaagggtggtggcctttgctgctgtagaa
ggagttttcttctcgggatcgtttgctgctatattctggttaaagaaaagaggtcttatg
cctggactcaccttttccaatgaactcatcagcagagatgaagggcttcactgtgacttt
gcttgcctgatgtttcgatacttggtaaataagccttcagaagaaagggccagggagatc
attgttaatgctgttaaaatcgagcagaagttcttaacagaagccttgcccgttggcctc
attggaatgaattctgttttgatgaaacagtatattgagtttgtagctgacagattactt
gtggaacttggattctcaaaattttttcaggcagaaaatccctttgattttatggaaaac
atttctttagaagggaaaacaaatttctttgagaaacgagtttcagagtatcagcgtttt
gcagtgatggcggaaaacacagataatgtcttcaccttggatgcagatttttga

KEGG   Miniopterus natalensis: 107526638
Entry
107526638         CDS       T05883                                 

Gene name
RRM2
Definition
(RefSeq) ribonucleoside-diphosphate reductase subunit M2
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
mna  Miniopterus natalensis
Pathway
mna00230  Purine metabolism
mna00240  Pyrimidine metabolism
mna00480  Glutathione metabolism
mna00983  Drug metabolism - other enzymes
mna01100  Metabolic pathways
mna04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107526638 (RRM2)
   00240 Pyrimidine metabolism
    107526638 (RRM2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107526638 (RRM2)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    107526638 (RRM2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    107526638 (RRM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mna03400]
    107526638 (RRM2)
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     107526638 (RRM2)
DNA repair and recombination proteins [BR:mna03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    107526638 (RRM2)
SSDB
Motif
Pfam: Ribonuc_red_sm
Other DBs
NCBI-GeneID: 107526638
NCBI-ProteinID: XP_016054644
LinkDB
Position
Unknown
AA seq 297 aa
MYKKAEASFWTAEEVDLSKDLQHWDTLKPEERHFISHVLAFFAASDGIVNENLVERFSQE
VQITEARCFYGFQIAMENIHSEMYSLLIDTYIKDSKEREFLFNAIETMPCVKKKADWALR
WIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDF
ACLMFKHLLHKPSEKRVKEIITNAVKIEQEFLTEALPVNLIGMNCTLMKRYIEFVADRLM
LELGFSKVFHVENPFDFMENISLEGKTNFFEKRVGEYQRMGVMSSPTENSFTLDADF
NT seq 894 nt   +upstreamnt  +downstreamnt
atgtataagaaggccgaggcgtccttctggacggccgaggaggtggacctttccaaggac
ctgcagcactgggacaccctgaagcccgaggagaggcacttcatttcccacgtcctggct
ttctttgcagccagcgacggcatagtgaatgagaacttggtggagcggtttagccaggag
gttcagatcaccgaggcccgctgcttctacggcttccaaattgccatggaaaacatacat
tctgaaatgtacagtctcctcattgacacctacattaaagattccaaagaaagggagttt
ctcttcaacgccatcgagacgatgccttgtgtcaagaagaaggcagactgggccttgcgc
tggattggggacaaagaggccacctatggagagcgtgttgtagcttttgctgcggtggaa
ggcatcttcttttctggttcttttgcatcaattttctggctcaagaagcggggactgatg
cctggcctcacgttttccaacgaactcattagcagagatgagggtctgcactgtgacttt
gcctgcctgatgttcaaacacctactgcacaaaccttctgagaagagagtgaaagaaata
attaccaatgctgttaagattgaacaggagttcctcacggaggccttgccggtgaacctc
atcgggatgaattgtactttgatgaagcggtacattgagttcgtggccgacagactcatg
ctggagctgggtttcagcaaggttttccacgtggaaaacccatttgacttcatggagaat
atttcgctggaagggaaaacgaacttctttgagaagagagtaggagagtaccagaggatg
ggagtgatgtcaagcccaacagagaattcttttaccctggatgctgacttctaa

KEGG   Miniopterus natalensis: 107544172
Entry
107544172         CDS       T05883                                 

Gene name
RRM1
Definition
(RefSeq) ribonucleoside-diphosphate reductase large subunit
  KO
K10807  ribonucleoside-diphosphate reductase subunit M1 [EC:1.17.4.1]
Organism
mna  Miniopterus natalensis
Pathway
mna00230  Purine metabolism
mna00240  Pyrimidine metabolism
mna00480  Glutathione metabolism
mna00983  Drug metabolism - other enzymes
mna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107544172 (RRM1)
   00240 Pyrimidine metabolism
    107544172 (RRM1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107544172 (RRM1)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    107544172 (RRM1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mna03400]
    107544172 (RRM1)
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     107544172 (RRM1)
DNA repair and recombination proteins [BR:mna03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    107544172 (RRM1)
SSDB
Motif
Pfam: Ribonuc_red_lgC Ribonuc_red_lgN ATP-cone
Other DBs
NCBI-GeneID: 107544172
NCBI-ProteinID: XP_016077448
LinkDB
Position
Unknown
AA seq 792 aa
MHVIKRDGRQERVMFDKITSRIQKLCYGLNMDFVDPAQITMKVIQGLYSGVTTVELDTLA
AETAATLTTKHPDYAILAARIAVSNLHKETKKVFSDVMEDLYNYINPHNGKHSPMVAKST
LDIVLANKDRLNSAIIYDRDFSYNYFGFKTLERSYLLKINGKVAERPQHMLMRVSVGIHK
EDIDAAIETYNLLSERWFTHASPTLFNAGTNRPQLSSCFLLSMKDDSIEGIYDTLKQCAL
ISKSAGGIGVAVSCIRATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAIY
LEPWHLDIFEFLDLKKNTGKEEQRARDLFFALWIPDLFMKRVETNQDWSLMCPNECPGLD
EVWGEEFEKLYESYEKQGRVRKVVKAQQLWYAIIESQTETGTPYMLYKDSCNRKSNQQNL
GTIKCSNLCTEIVEYTSKDEVAVCNLASLALNMYVTPEHTYDFKKLAEVTKVIVRNLNKI
IDINYYPIPEAYLSNKRHRPIGIGVQGLADAFILMRYPFESPEAQLLNKQIFETIYYGAL
EASCDLAREHGPYETYEGSPVSKGILQYDMWNVTPTDLWDWKLLKEKIAKYGIRNSLLLA
PMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERNLWNEEMKNQII
ACNGSIQTIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKL
TSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKASKEEEEKERNTAAMVCS
LENRDECMMCGS
NT seq 2379 nt   +upstreamnt  +downstreamnt
atgcatgtgatcaagcgagatggccgccaagaacgggtcatgtttgacaaaattacatct
cgaatccagaaactttgttatggactcaatatggactttgttgatcctgctcagatcacc
atgaaagtaatccaaggcttatacagtggggtcactactgtggaactagatactttggct
gctgaaacagcggcaaccttgactactaagcaccctgactatgccattctggcagcacgg
attgctgtctctaacttgcacaaagaaacaaagaaagtattcagtgatgtgatggaagac
ctctacaactacataaatccacataatggcaaacactctcccatggtggccaagtcaaca
ctggatattgttttggccaataaagatcgcctgaattctgctattatctatgaccgagat
ttctcttataattactttggctttaagaccctggagcggtcctatttgttgaagatcaat
ggaaaagtggctgaaagaccacaacatatgttgatgagggtatctgtggggattcacaaa
gaagatatagatgctgctattgaaacatacaaccttctttctgagaggtggtttacccat
gcctctcccactctcttcaatgctggtaccaaccgcccacaactttctagctgtttcctt
ctgagtatgaaagatgatagtattgaaggcatttatgacacactaaagcagtgtgcattg
atttccaagtctgctgggggaattggtgttgctgtgagttgtattcgagctactggcagc
tacattgctgggactaatggcaattccaatggccttgtaccgatgctgagagtatataac
aatacagctcgatatgtggatcaaggtggaaacaagcgacctggggcatttgctatttac
ctggagccttggcatttagacatctttgagtttcttgatttaaagaagaacacaggaaag
gaagaacagcgtgccagggaccttttctttgccctttggattccagatctcttcatgaaa
cgagtggagactaatcaggactggtctttaatgtgtccgaatgagtgtcctggtctggat
gaggtttggggagaggaatttgagaagctatatgaaagttatgagaaacagggtcgagtt
cgtaaagttgtaaaagcgcaacagctttggtatgccattattgagtctcagacagagaca
ggtaccccgtacatgctttacaaagattcctgtaatcggaagagcaaccagcagaacctg
ggaacgatcaaatgtagcaacctgtgcacagaaatagtagaatataccagcaaagatgag
gttgcagtttgtaacttggcttccctggccctgaatatgtatgtcactccagaacacaca
tacgactttaagaagctggctgaagtcaccaaagtcattgtccggaatttgaataaaatt
attgatattaactactaccctatcccagaggcatacttatcaaataaacgccatcgcccc
attggaattggggtacaaggtctggcagatgcttttattctgatgaggtatccttttgag
agtccagaggcccagttattgaataagcaaatctttgaaaccatttattatggagctttg
gaagccagctgtgatctggccagggagcatggcccatatgaaacctacgagggctctcca
gtcagcaaaggaatccttcagtatgatatgtggaatgttactcccaccgacctatgggac
tggaaacttctcaaggagaagattgcaaagtatggtataagaaacagtttacttcttgcc
ccaatgcctactgcttccactgctcagattctgggaaataatgagtccattgaaccttac
accagcaacatctacactcgcagagtcttgtcaggagaatttcagattgtaaatcctcac
ttactgaaagatcttactgagcggaacttgtggaatgaagagatgaaaaatcagattatt
gcgtgcaatggctctatccagaccataccagaaattcctgatgacctgaagcaactttat
aaaactgtatgggaaatctctcagaaaaccgttctcaagatggcagccgagagaggtgct
ttcattgaccaaagccagtctttgaacatccatattgctgagcctaactatggcaaactc
actagtatgcacttctacggctggaagcagggtttgaagactgggatgtattatttaagg
acaagaccagcagctaatcctatccagttcactctaaataaagagaagctgaaagataag
gaaaaggcatcgaaagaggaagaagagaaggagaggaacacagcagccatggtgtgctct
ttggagaacagagatgagtgtatgatgtgtgggtcctga

DBGET integrated database retrieval system