KEGG   Miniopterus natalensis: 107526355
Entry
107526355         CDS       T05883                                 

Gene name
RAB5A
Definition
(RefSeq) ras-related protein Rab-5A
  KO
K07887  Ras-related protein Rab-5A
Organism
mna  Miniopterus natalensis
Pathway
mna04014  Ras signaling pathway
mna04144  Endocytosis
mna04145  Phagosome
mna04962  Vasopressin-regulated water reabsorption
mna05014  Amyotrophic lateral sclerosis
mna05022  Pathways of neurodegeneration - multiple diseases
mna05132  Salmonella infection
mna05146  Amoebiasis
mna05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107526355 (RAB5A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107526355 (RAB5A)
   04145 Phagosome
    107526355 (RAB5A)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107526355 (RAB5A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107526355 (RAB5A)
   05022 Pathways of neurodegeneration - multiple diseases
    107526355 (RAB5A)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107526355 (RAB5A)
   05152 Tuberculosis
    107526355 (RAB5A)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107526355 (RAB5A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107526355 (RAB5A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107526355 (RAB5A)
   04031 GTP-binding proteins [BR:mna04031]
    107526355 (RAB5A)
Membrane trafficking [BR:mna04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab GTPases
    107526355 (RAB5A)
 Endosome - Lysosome transport
    107526355 (RAB5A)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107526355 (RAB5A)
  Exosomal proteins of other body fluids (saliva and urine)
   107526355 (RAB5A)
  Exosomal proteins of colorectal cancer cells
   107526355 (RAB5A)
  Exosomal proteins of bladder cancer cells
   107526355 (RAB5A)
GTP-binding proteins [BR:mna04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    107526355 (RAB5A)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA RsgA_GTPase GTP_EFTU AAA_16 MCR_beta BrnT_toxin
Other DBs
NCBI-GeneID: 107526355
NCBI-ProteinID: XP_016054265
LinkDB
Position
Unknown
AA seq 215 aa
MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ
TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR
QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK
LPKNEPQNPGANSARGRGVDLTEPTQPTRSQCCSN
NT seq 648 nt   +upstreamnt  +downstreamnt
atggctaatcgaggagcaacaagacccaacgggccaaatactggaaataaaatatgccag
ttcaaactagtacttctgggagagtctgctgttggcaaatcaagcctagtgcttcgtttt
gtgaaaggccaatttcatgaatttcaagagagtaccatcggggctgcttttctaactcaa
actgtgtgtcttgatgacacaacagtaaagtttgaaatatgggatacagctggtcaagag
cgataccatagcctagcaccaatgtactacagaggagcacaagcagccatagttgtgtat
gatatcacaaatgaggagtcctttgccagagccaaaaattgggttaaagaacttcagagg
caagccagtcctaacattgtaatagctttatcaggaaacaaggctgaccttgcaaataaa
agagctgtcgatttccaggaagcacagtcatatgcagatgacaacagtttattattcatg
gagacatcagctaaaacatcaatgaatgtaaatgaaatattcatggcaatagctaaaaag
ttgccaaagaatgaaccacagaatccaggagcaaattctgccaggggaagaggagtagac
cttactgaacccacacagccaaccaggagtcagtgttgtagtaactaa

KEGG   Miniopterus natalensis: 107538222
Entry
107538222         CDS       T05883                                 

Gene name
RAB5B
Definition
(RefSeq) ras-related protein Rab-5B
  KO
K07888  Ras-related protein Rab-5B
Organism
mna  Miniopterus natalensis
Pathway
mna04014  Ras signaling pathway
mna04144  Endocytosis
mna04145  Phagosome
mna04962  Vasopressin-regulated water reabsorption
mna05132  Salmonella infection
mna05146  Amoebiasis
mna05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107538222 (RAB5B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107538222 (RAB5B)
   04145 Phagosome
    107538222 (RAB5B)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107538222 (RAB5B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107538222 (RAB5B)
   05152 Tuberculosis
    107538222 (RAB5B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107538222 (RAB5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107538222 (RAB5B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107538222 (RAB5B)
   04031 GTP-binding proteins [BR:mna04031]
    107538222 (RAB5B)
Membrane trafficking [BR:mna04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab GTPases
    107538222 (RAB5B)
 Endosome - Lysosome transport
    107538222 (RAB5B)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107538222 (RAB5B)
  Exosomal proteins of other body fluids (saliva and urine)
   107538222 (RAB5B)
  Exosomal proteins of colorectal cancer cells
   107538222 (RAB5B)
  Exosomal proteins of melanoma cells
   107538222 (RAB5B)
GTP-binding proteins [BR:mna04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    107538222 (RAB5B)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase Gtr1_RagA GTP_EFTU AAA_16
Other DBs
NCBI-GeneID: 107538222
NCBI-ProteinID: XP_016069878
LinkDB
Position
Unknown
AA seq 215 aa
MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQ
SVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQR
QASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKK
LPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN
NT seq 648 nt   +upstreamnt  +downstreamnt
atgactagcagaagcacagccaggcccaatgggcagccccaggccagcaaaatatgccag
ttcaaattggtcctgttgggtgaatctgcagtggggaaatctagcctggtgttacgtttt
gttaaagggcagttccatgaataccaggagagcaccattggagcggccttcctcacccag
tctgtttgcctagatgacacaacagtcaagtttgagatctgggacacagcagggcaggag
cgataccatagcttggcccctatgtactacagaggtgcccaagctgcaatcgtggtgtat
gacattactaatcaggaaacctttgccagagcgaagacatgggtaaaggaactacagcga
caggccagtcctagcattgttattgccctggcaggaaacaaagctgacctggccaacaag
cgcatggtggagtatgaagaggcccaagcatatgcagatgacaacagcttactgtttatg
gagacctcagccaagacagctatgaacgtgaacgatctcttcctggcaatagctaagaag
ttgccaaagagtgaaccccagaatctggggggtgcagcaggccgaagccgaggtgtggat
ctccatgagcagtcccagcagaacaagagccagtgttgtagcaactga

KEGG   Miniopterus natalensis: 107544208
Entry
107544208         CDS       T05883                                 

Gene name
RAB5C
Definition
(RefSeq) ras-related protein Rab-5C
  KO
K07889  Ras-related protein Rab-5C
Organism
mna  Miniopterus natalensis
Pathway
mna04014  Ras signaling pathway
mna04144  Endocytosis
mna04145  Phagosome
mna04962  Vasopressin-regulated water reabsorption
mna05132  Salmonella infection
mna05146  Amoebiasis
mna05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107544208 (RAB5C)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107544208 (RAB5C)
   04145 Phagosome
    107544208 (RAB5C)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107544208 (RAB5C)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107544208 (RAB5C)
   05152 Tuberculosis
    107544208 (RAB5C)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107544208 (RAB5C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107544208 (RAB5C)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107544208 (RAB5C)
   04031 GTP-binding proteins [BR:mna04031]
    107544208 (RAB5C)
Membrane trafficking [BR:mna04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab GTPases
    107544208 (RAB5C)
 Endosome - Lysosome transport
    107544208 (RAB5C)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107544208 (RAB5C)
  Exosomal proteins of other body fluids (saliva and urine)
   107544208 (RAB5C)
  Exosomal proteins of colorectal cancer cells
   107544208 (RAB5C)
  Exosomal proteins of bladder cancer cells
   107544208 (RAB5C)
GTP-binding proteins [BR:mna04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    107544208 (RAB5C)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA RsgA_GTPase GTP_EFTU AAA_16
Other DBs
NCBI-GeneID: 107544208
NCBI-ProteinID: XP_016077498
LinkDB
Position
Unknown
AA seq 216 aa
MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLT
QTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQ
RQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAK
KLPKNEPQNTAGAPGRNRGVDLQENNPASRSQCCSN
NT seq 651 nt   +upstreamnt  +downstreamnt
atggcgggtcggggaggtgcagcacgacccaatggaccagctgctgggaacaagatctgt
caatttaagctggtcctgctgggggagtctgcagtaggcaaatccagccttgtcctccgc
tttgtcaagggacaattccacgagtaccaggagagcacaattggagcggccttcctcaca
cagactgtctgcttggacgacacaacagtcaagtttgagatctgggacacagctggacag
gagcggtatcacagcctggcccccatgtactatcggggggcccaggctgccatcgtggtc
tatgacatcaccaacacagatacgtttgcacgggccaagaactgggtgaaggagttacag
aggcaggccagccccaacatcgtcatcgcgctggcgggtaacaaggcagacctggccagc
aagagagccgtggaattccaggaagcacaagcctatgcagatgacaacagtttgctgttc
atggagacatcagcaaagacagcaatgaatgtgaatgaaattttcatggcaatagctaag
aagctcccgaagaatgagccccagaatacagcgggtgccccaggccggaaccgaggtgtg
gacctccaggagaacaacccagccagccggagccagtgctgcagcaactga

DBGET integrated database retrieval system