KEGG   Miniopterus natalensis: 107526366
Entry
107526366         CDS       T05883                                 

Gene name
TOP2B
Definition
(RefSeq) DNA topoisomerase 2-beta
  KO
K03164  DNA topoisomerase II [EC:5.6.2.2]
Organism
mna  Miniopterus natalensis
Pathway
mna01524  Platinum drug resistance
Brite
KEGG Orthology (KO) [BR:mna00001]
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107526366 (TOP2B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mna03032]
    107526366 (TOP2B)
   03036 Chromosome and associated proteins [BR:mna03036]
    107526366 (TOP2B)
Enzymes [BR:mna01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     107526366 (TOP2B)
DNA replication proteins [BR:mna03032]
 Eukaryotic type
  DNA Topoisomerases
   107526366 (TOP2B)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Chromosome condensation proteins
   Other regulators of chromosome condensation
    107526366 (TOP2B)
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    107526366 (TOP2B)
SSDB
Motif
Pfam: DNA_topoisoIV TOPRIM_C DNA_gyraseB DTHCT HATPase_c Toprim
Other DBs
NCBI-GeneID: 107526366
NCBI-ProteinID: XP_016054277
LinkDB
Position
Unknown
AA seq 1544 aa
MWVYDEDVGMNCREVTFVPGLYKIFDEILVNAADNKQRDKNMTCIKVSIDPESNIISIWN
NGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVE
TACKEYKHSFKQTWMNNMMKTSEAKIKHFDGEDYTCITFQPDLSKFKMEKLDKDIVALMT
RRAYDLAGSCKGVKVMFNGKKLPVNGFRSYVDLYVKDKLDETGVALKVIHELANERWDVC
LTLSEKGFQQISFVNSIATTKGGRHVDYVVDQVVGKLIEVVKKKNKAGVSVKPFQVKNHI
WVFINCLIENPTFDSQTKENMTLQPKSFGSKCQLSEKFFKAASNCGIVESILNWVKFKAQ
TQLNKKCSSVKYSKIKGIPKLDDANDAGGKHSLDCTLILTEGDSAKSLAVSGLGVIGRDR
YGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKSYDDAESLKTLRYGKIMIMT
DQDQDGSHIKGLLINFIHHNWPSLLKHGFLEEFITPIVKASKNKQELSFYSIPEFDEWKK
HIENQKAWKIKYYKGLGTSTAKEAKEYFADMERHRILFRYAGPEDDAAITLAFSKKKIDD
RKEWLTNFMEDRRQRRLHGLPEQFLYGTATKHLTYNDFINKELILFSNSDNERSIPSLVD
GFKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHHGEQALMMTIVNLAQNFVGSNN
INLLQPIGQFGTRLHGGKDAASPRYIFTMLSSLARRLFPVVDDNLLKFLYDDNQRVEPEW
YIPIIPMVLINGAEGIGTGWACKLPNYDAREIVNNVRRMLDGLDPHPMLPNYKNFKGTIQ
ELGQNQYAVSGEIFVVDRNTVEITELPVRTWTQVYKEQVLEPMLNGTDKTPALISDYKEY
HTDTTVKFVVKMTEEKLAQAEAAGLHKVFKLQTTLTCNSMVLFDHMGCLKKYETVQDILK
EFFDLRLSYYGLRKEWLVGMLGAESTKLNNQARFILEKIQGKITIENRSKKDLIQMLVQR
GYESDPVKAWKEAQEKATEEEETQNQHDDSSSDSGTPSGPDFNYILNMSLWCLTKEKVEE
LIKQRDTKGREVNDLKRKSPSDLWKEDLAAFVEELDKVEAQEREDLMAGMAGKAIKGKVG
KPKVKKLQLEETMPSPYGRRIVPEITAMKADASKKLLKKKKGDLDTSAVKVEFDEEFSGT
PVEGTGEEALIQSVPINKGPKPKREKKEPGTRVRKRKASTSSGKTSTKKVKKRNPWSDDE
SKSESDLEETEPVVIPRDSLLRRAAAERPKYTFDFSEEEDDDADDDDDNNDLEELKVKAS
PITNDGEDEFVPSDGLDKDEYTFSPGKSKAIPEKSSHDKKTQDFGNLFSFPSYSQKSEDD
SAKFDSNEEDSASVFSPSFGLKQIDKVPSKTVAAKKGKPSSDTAPKPKRTPKQKKVETIN
SDSDSEFGIPKKTTTPKGKGRGARKRKASGSENEGDYNPGRKTARPPSKKLKKTSFDQDS
DVDIFPSDFTSEPPSLPRTGRARKEVKYFVESDEEEDVDFAMFN
NT seq 4635 nt   +upstreamnt  +downstreamnt
atgtgggtgtatgatgaagatgtaggaatgaattgcagagaggttacctttgtgccaggt
ttatacaagatctttgatgaaatcttggttaatgcagctgacaataaacagagagataag
aacatgacctgtattaaagtttccatcgatcctgaatctaacattataagcatttggaat
aatgggaaaggcattccagtagtagaacataaagtagagaaagtttatgttcctgcctta
atttttggacagcttttaacatccagtaactatgatgatgatgagaaaaaagtaacaggt
ggtcgaaatggttatggtgcaaaactttgtaatattttcagtacaaagtttacagtagaa
actgcttgcaaagaatacaaacatagttttaaacagacatggatgaataatatgatgaag
acttctgaagccaaaattaaacattttgatggtgaagattacacatgcataacattccaa
ccagatctgtccaaatttaagatggaaaaacttgacaaggatattgtggccctcatgacc
agaagagcgtatgatttggctggttcatgcaaaggggtcaaggttatgtttaatggaaag
aaattgcctgtaaatgggtttcgaagttatgtagatctttatgtgaaagacaaattggat
gaaactggagtggccctgaaagttattcatgaactcgcaaatgaaagatgggatgtttgc
ctgacactgagtgagaaaggatttcagcaaatcagctttgtaaatagtattgcaacgaca
aaaggtggacgacatgtggattatgtagttgatcaagttgttggtaaactgattgaagta
gtcaagaaaaagaacaaagctggtgtatcagtgaaaccatttcaagtaaaaaatcatata
tgggtttttattaattgccttattgaaaacccaacttttgattctcagactaaggaaaac
atgactctgcagcccaaaagttttgggtccaaatgccaactgtcagaaaaatttttcaaa
gcagcctctaattgtggcattgtagaaagtatcctgaactgggtgaaatttaaggctcag
actcagctaaacaagaagtgttcatcagtaaagtatagtaaaatcaaaggtattcctaaa
ctggatgatgcaaatgatgctggtggcaaacattccttggattgtacactgatattaaca
gagggagactctgccaaatcgctggcggtgtctggattaggtgtgattgggcgagacaga
tatggagtctttccactcaggggaaaaattcttaacgtacgggaagcttctcataaacag
atcatggaaaacgcagaaataaacaatattattaaaatagttggtctacaatacaagaaa
agttatgatgatgcagaatctctgaaaactttgcgctatggaaagattatgattatgact
gatcaggatcaagatggttctcacataaaaggcctgcttattaatttcatccaccacaat
tggccatcacttttgaagcatggttttcttgaagagttcattactccaattgtaaaggca
agcaaaaataagcaggaactttccttctacagtattcctgaatttgatgagtggaaaaaa
catatagaaaaccagaaagcctggaaaataaaatactacaaagggttgggtaccagtaca
gctaaagaagcaaaggaatattttgctgacatggaaaggcaccgcatcttgtttagatat
gctggtcctgaagatgatgctgccattacgttggcattcagtaaaaagaagattgatgac
agaaaagaatggttaacaaattttatggaagatcggagacagcgtaggttacatggatta
ccagagcaatttttatatggtacagcaacaaagcatttgacatacaatgatttcatcaat
aaggaattgattctcttctcaaactcagacaatgaaaggtctataccatctcttgttgat
ggttttaaaccaggccaacgaaaagttttatttacctgtttcaaaaggaatgacaaacgc
gaagttaaagttgcccagctggctggatctgttgctgagatgtctgcttatcatcatgga
gaacaagcattgatgatgactattgtgaatttggctcagaactttgtgggaagtaacaac
attaacttgcttcaacctattggtcagtttggaactcggcttcatggtggcaaagatgct
gcaagccctcgttacattttcacaatgttaagctctttagcaagacggctttttcctgtt
gtggatgacaacctgcttaaattcctttacgatgacaatcaacgagtagagcctgagtgg
tatattcccataattcccatggttttaataaatggtgctgagggcattggtactggatgg
gcttgtaaattacccaactatgatgctagggaaattgtgaacaatgtcaggcgaatgctg
gatggcttggatccccatcccatgcttccaaactacaaaaactttaaaggaacaatccaa
gaacttggtcagaaccaatatgcagtcagtggtgaaatttttgtggtggatagaaacaca
gtggagattacagagcttccagttaggacttggacacaggtatacaaagagcaggtttta
gaacctatgctaaatggaacagataaaacaccagcattaatttctgattataaagaatat
cacactgatacaactgtgaaatttgtcgtgaaaatgactgaagagaaactagcacaagca
gaagctgctggactgcacaaagtttttaaacttcaaactactcttacttgtaattccatg
gtactctttgatcatatgggatgtctgaagaagtatgaaactgtacaagacattttgaaa
gaattctttgatttgcgattaagttattatggtttacgtaaggagtggcttgtagggatg
ttgggcgcagaatctacaaagcttaacaatcaagctcgtttcattttagagaagatacaa
gggaaaattactatagagaataggtcaaagaaagatttgattcaaatgttagtccagaga
ggttatgaatctgacccagtgaaagcctggaaagaagcacaagaaaaggcaacagaagag
gaagaaacacaaaaccagcatgatgatagttcctctgattcaggaactccttcaggccct
gattttaattatattttaaatatgtctctgtggtgtcttactaaagaaaaagttgaagaa
ctgattaagcagagagatacaaaagggcgagaggttaatgatcttaaaagaaaatctcct
tcggatctttggaaagaagacttagcagcatttgttgaagaactggataaagtggaagcg
caagaacgagaagatttaatggctggaatggctggaaaagcaataaaaggtaaagttggc
aaacctaaggtgaagaaacttcaattggaagagacaatgccctcaccttatgggaggaga
atagttcccgaaattactgctatgaaggcagatgccagcaaaaagttgctgaagaagaaa
aagggtgatcttgatacctcagcagtaaaagtggaatttgatgaagaattcagtggaaca
ccagtagaaggtacaggagaagaagcattgatccagtcagtgcctataaataaaggtccc
aaacccaaaagggagaagaaggagcctggtaccagggtgagaaaaagaaaagcatctaca
tcatctggcaaaaccagtacaaagaaagtgaagaagcggaatccttggtcagatgatgag
tccaagtcagaaagtgacttggaagaaacagaacctgtggttattccaagagattctttg
cttaggagagcagctgccgagaggcctaagtacacattcgacttctcagaagaggaggat
gatgatgctgatgatgatgatgacaataatgacttagaggaattaaaagttaaagcatct
cccataacgaatgatggggaagatgaatttgttccttcagatggcctagataaagatgaa
tatacattttcaccaggcaaatcaaaagctattccagaaaaatcttcacatgacaaaaaa
actcaggattttgggaatctcttctcatttccttcatactctcagaagtcagaagatgat
tcagctaaatttgacagtaatgaagaagattctgcttctgttttttcaccatcatttggt
ctgaaacaaatagataaagttccaagtaaaacagtagctgctaaaaagggaaaaccatct
tcagatacagcccctaagcccaagagaacccccaaacagaagaaagtggagactataaac
tctgactcagattcagaatttggcattccaaagaagactacaacaccaaaaggtaaaggc
cgaggggcaaggaaaagaaaagcatctggctctgaaaatgaaggcgattataaccctggc
aggaaaacagccagaccaccaagcaagaaactgaagaaaacatcttttgatcaggattca
gatgtggacatcttcccctcagacttcacttctgaaccaccttctctgccacggaccggt
cgagctaggaaagaagtaaaatattttgtagagtctgatgaagaagaagatgttgacttt
gcaatgtttaattaa

KEGG   Miniopterus natalensis: 107528991
Entry
107528991         CDS       T05883                                 

Gene name
TOP2A
Definition
(RefSeq) DNA topoisomerase 2-alpha
  KO
K03164  DNA topoisomerase II [EC:5.6.2.2]
Organism
mna  Miniopterus natalensis
Pathway
mna01524  Platinum drug resistance
Brite
KEGG Orthology (KO) [BR:mna00001]
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107528991 (TOP2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mna03032]
    107528991 (TOP2A)
   03036 Chromosome and associated proteins [BR:mna03036]
    107528991 (TOP2A)
Enzymes [BR:mna01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     107528991 (TOP2A)
DNA replication proteins [BR:mna03032]
 Eukaryotic type
  DNA Topoisomerases
   107528991 (TOP2A)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Chromosome condensation proteins
   Other regulators of chromosome condensation
    107528991 (TOP2A)
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    107528991 (TOP2A)
SSDB
Motif
Pfam: DNA_topoisoIV TOPRIM_C DNA_gyraseB DTHCT HATPase_c Toprim Filaggrin
Other DBs
NCBI-GeneID: 107528991
NCBI-ProteinID: XP_016057731
LinkDB
Position
Unknown
AA seq 1530 aa
MEVSPLQPVNENMQINRTKKNEDAKKRLSIERIYQKKTQLEHILLRPDTYIGSVELVTQQ
MWVYDEDIGINYREVTFVPGLYKIFDEILVNAADNKQRDPKMSCIRVTIDPENNLISIWN
NGKGIPVVEHKVEKMYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVE
TASREYKKMFKQTWMDNMGRASEMELKPFNGEDYTCITFQPDLSKFKMQSLDKDIVALMV
RRAYDIAGSTKDVKVFLNGNKLPVKGFRSYVDMYLKDKVDETGNPLKIIHEQVNHRWEVC
LTMSEKGFQQISFVNSIATSKGGRHVDYVADQIVAKLVDVVKKKNKGGVAVKAHQVKNHM
WIFVNALIENPTFDSQTKENMTLQVKSFGSTCQLSEKFIKAAIGCGIVESILNWVKFKAQ
VQLNKKCSAVKHNRIKGIPKLDDANDAGGRNSTDCTLILTEGDSAKTLAVSGLGVVGRDK
YGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKNYEDEDSLKTLRYGRIMIMT
DQDQDGSHIKGLLINFIHHNWPSLLRHRFLEEFITPIVKVSKNKQEMSFYSLPEFEEWKN
STANHKKWKVKYYKGLGTSTSKEAKEYFADMKRHRIQFKYSGPEDDAAISLAFSKKQIDD
RKEWLTHFMEDRRQRKLLGLPEDYLYGQTTTYLTYNDFINKELILFSNSDNERSIPSMVD
GLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSSYHHGEMSLMMTIINLAQNFVGSNN
LNLLQPIGQFGTRLHGGKDSASPRYIFTMLSPLARLLFPPKDDHTLKFLYDDNQRVEPEW
YIPIIPMVLINGAEGIGTGWSCKIPNFDIREVVNNIRRLMDGEEPLPMLPSYKNFKGTIE
ELVPNQYVISGEVAILNSTTIEISELPVRTWTQTYKEQVLEPMLNGTEKTPPLITDYREY
HTDTTVKFVVKMTEEKLAEAEKAGLHKVFKLQTSLTCNSMVLFDHVGCLKKYDTVLDILR
DFFELRLKYYGLRKEWLLGMLGAESAKLNNQARFILEKIDGKIIIENKPKKELIKVLVQR
GYDSDPVKAWKEAQQKVPEEEENEESDNEKETEKSDSATGPTFNYLLDMPLWYLTKEKKD
ELCKLRNEKEQELETLKRKSPSDLWKEDLAAFVEELEAVEAKEKQDEQVGLPGKGGKGKG
KKTQMTEVLPSPSGKRVIPRVTTEMKAEAEKKIKRKIKNENAEGSPQEDSVEPESLKQRL
EKKQKREPGTKSKKQTTLPFKPIKKGKKRNPWSDSESDMSSNESDFDVPPREIEPRRAAT
KTKFTVDLDSDEDFSDIDKKSEDEDFVPSDASPVKIKTSPKRMNKELKPQKSTTSVIDLD
GDDAKDNVLSPNSPAADFPAETEIINPVSKKNVTVKKTVAKGQSSTSTTGAKKRAAPKGT
KKDPGLTSDVPQKPDPRKTKNRRKRKPSTSDDSDSNFEKAISKAVTSKKSKGESDDFHLD
LDSAVAPRVKSGRAKKPIKYLEESDEDDLF
NT seq 4593 nt   +upstreamnt  +downstreamnt
atggaggtgtcaccactgcagcctgtaaatgaaaatatgcaaatcaacagaacaaagaaa
aatgaagatgctaagaaaagactgtctattgaaagaatctatcaaaagaaaacacaattg
gaacatattttgctgcgtccagacacctacattggctctgtggaattagtgactcagcaa
atgtgggtttatgatgaagatattggcatcaactacagggaagtcacttttgttcctggt
ttgtacaaaatatttgatgagattctagtcaatgctgcagacaacaaacaaagggaccca
aaaatgtcttgtattagagtcacaattgacccggaaaataatttaattagtatatggaat
aatggaaaaggtattcctgttgttgaacacaaagttgagaagatgtatgtcccagctctc
atctttggacagctcttaacctcaagtaactatgatgatgatgaaaagaaagtaacaggt
ggtcgtaatggctatggagccaaattgtgtaatatattcagtaccaaatttactgtggaa
acagccagtagagaatacaagaaaatgttcaaacagacatggatggataacatggggaga
gccagtgagatggaactcaagccctttaatggagaagattatacatgtattaccttccag
cctgatttgtctaagtttaaaatgcaaagcctagacaaagatattgttgcactaatggtt
agaagagcgtatgatattgctggatccactaaagatgtcaaagtctttctcaatggaaat
aagctgccagtgaaaggattccgtagctatgtggatatgtatttgaaggataaggtagat
gaaacgggcaatccattgaagattatccatgaacaagtaaaccacaggtgggaagtatgt
ttaacaatgagtgaaaaaggctttcaacaaattagctttgtcaacagcattgctacttcc
aagggtggcagacatgttgattatgtagctgatcagattgtggctaaacttgttgatgtt
gtgaagaagaagaacaagggtggtgttgcagtaaaagcacatcaggtgaaaaatcacatg
tggatttttgtgaatgccttaattgaaaatccaacctttgactctcagacaaaagaaaac
atgactttacaagtcaagagttttggatcaacatgccaattaagtgaaaagttcatcaaa
gctgcaattggctgtggtattgtagaaagcatactaaactgggtgaagtttaaggctcaa
gtccagttaaacaagaagtgttcagctgtaaaacataacagaatcaagggaattcccaaa
cttgatgatgccaatgatgcaggaggccgaaactctactgactgtacacttattctgact
gaaggagactcagctaaaaccttggctgtttcaggccttggtgtggttgggagagacaag
tacggggttttccctcttagaggaaaaatactcaatgttcgggaagcttctcataaacag
ataatggaaaatgccgaaattaacaatatcataaagattgtgggtcttcagtacaagaaa
aactatgaagatgaagattcactgaagactcttcgttatgggaggataatgattatgaca
gatcaggaccaagatggttcccatatcaaaggcttgctgattaattttatccatcacaac
tggccctctcttctgcgacatcgttttctggaggaatttattactcccattgtaaaggtg
tctaaaaacaagcaagaaatgtctttctatagccttcctgaatttgaagaatggaagaat
tctacagcaaatcataaaaaatggaaagtcaagtattacaaaggtttgggcaccagcaca
tcaaaagaagctaaagaatactttgcagatatgaaaagacatcgtatccagttcaaatat
tctggtcccgaagatgatgctgcaatcagcctggcctttagcaaaaaacagatagatgat
cgaaaggaatggttaactcatttcatggaggatagaagacaacggaagttacttggcctt
cctgaggattacttgtatgggcaaactaccacatatctgacgtacaatgacttcataaac
aaggaacttatcctgttctcaaattctgataatgagagatctatcccatctatggtggat
ggtttgaaaccaggtcagagaaaggttttgtttacatgtttcaagcggaatgacaagcga
gaggtgaaggttgcccagttagctgggtcagtggctgagatgtcctcttaccatcatggt
gagatgtcactaatgatgaccattatcaatttggctcagaattttgtgggtagcaataat
ttgaacctcttacaacccattggtcagtttggtaccaggctgcatggtggcaaggattct
gctagtcctcgatacatcttcacaatgctcagtcctttggctcggttgttatttccacca
aaagatgatcacacattaaagttcttgtatgatgacaaccaacgtgtggagcctgaatgg
tacattcctattatacctatggtgctcataaatggtgctgaaggaattggtactgggtgg
tcctgcaaaatccccaactttgatattcgtgaagttgtgaataacatcaggcgtttgatg
gacggagaagaacctttgccaatgcttccaagttacaagaacttcaagggtactattgaa
gagctggttccaaatcaatatgtgattagcggtgaagtggctattcttaattccacaacc
attgaaatctcagagcttcccgtcagaacatggacccagacatacaaagaacaggttcta
gaacccatgttgaatggcactgagaagacgcctcctctcataacagattatagggaatat
catacagatactactgtgaagtttgttgtgaagatgactgaagaaaaactggctgaggct
gagaaagctggactacacaaagtcttcaaactccaaactagtctcacatgcaactctatg
gtgctatttgaccacgtaggctgtttaaagaaatatgacacagtgcttgatattctaaga
gacttctttgaactcaggcttaaatattatggattaagaaaagaatggcttctaggaatg
cttggcgctgaatctgctaaactgaacaatcaggcacgctttatcttagagaaaatagat
ggcaaaataataattgaaaacaagcctaagaaagaattaattaaagttttggttcagagg
ggatatgattcagatcctgtgaaggcttggaaagaagcccagcaaaaggttccagaagaa
gaagaaaatgaagagagtgacaatgaaaaggaaactgaaaagagtgactctgcaactgga
ccaactttcaactaccttcttgatatgcctctttggtatctaactaaagaaaagaaagat
gaactgtgcaaactaagaaacgaaaaagagcaagagctggaaacattaaagagaaagagt
ccatcagatttgtggaaagaagacttggctgcttttgttgaagagctagaggctgttgaa
gccaaggaaaaacaagatgaacaagtaggacttcctgggaaaggagggaaaggaaagggg
aaaaaaacacaaatgactgaagttttgccttctccaagtggaaaaagagtcatcccccga
gtgaccacagagatgaaagcagaggcagaaaagaaaattaaaaggaaaattaagaatgaa
aatgctgaagggagtcctcaagaggatagtgtggaaccagaaagcctaaaacaaagatta
gagaagaaacagaaaagagaaccaggtaccaagtcaaagaaacaaactacattgccattt
aaaccaatcaaaaaaggaaagaagagaaacccctggtctgattcggaatcagatatgagc
agtaacgaaagtgattttgatgtccctccacgagaaatagagccacgaagagcagcaaca
aaaactaaattcacagtggatttggattcagatgaagatttctcagatattgataaaaaa
agtgaagatgaagattttgtcccatcagatgctagtccagttaagatcaaaacttcccca
aaacgtatgaacaaagaattgaagccacagaagagcaccacctcagtcatagaccttgat
ggtgatgatgccaaggacaatgtactttctccgaattcacctgctgctgatttcccagct
gaaactgaaatcataaaccctgtttctaaaaagaatgtgacagtgaagaagacggtggca
aaaggtcagtcttccacctccactacaggtgccaaaaaaagggctgcaccaaagggaacc
aaaaaggatccaggcttgacttctgatgtccctcaaaagcctgatccccgcaaaaccaag
aatcgccgcaaaaggaagccatccacttctgatgattctgactctaattttgagaaagcg
atttctaaagcagtcacaagcaagaaatccaagggagagagtgatgacttccatctggac
ttggactctgctgtggctcctcgggtaaaatctggacgggcaaagaagcctataaaatat
cttgaagaatcagatgaagatgatctattttaa

DBGET integrated database retrieval system