KEGG   Miniopterus natalensis: 107526381
Entry
107526381         CDS       T05883                                 

Gene name
TGFBR2
Definition
(RefSeq) TGF-beta receptor type-2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04060  Cytokine-cytokine receptor interaction
mna04068  FoxO signaling pathway
mna04144  Endocytosis
mna04218  Cellular senescence
mna04350  TGF-beta signaling pathway
mna04380  Osteoclast differentiation
mna04390  Hippo signaling pathway
mna04520  Adherens junction
mna04659  Th17 cell differentiation
mna04926  Relaxin signaling pathway
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna05142  Chagas disease
mna05161  Hepatitis B
mna05166  Human T-cell leukemia virus 1 infection
mna05200  Pathways in cancer
mna05202  Transcriptional misregulation in cancer
mna05210  Colorectal cancer
mna05212  Pancreatic cancer
mna05220  Chronic myeloid leukemia
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107526381 (TGFBR2)
   04350 TGF-beta signaling pathway
    107526381 (TGFBR2)
   04390 Hippo signaling pathway
    107526381 (TGFBR2)
   04068 FoxO signaling pathway
    107526381 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107526381 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107526381 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    107526381 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107526381 (TGFBR2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    107526381 (TGFBR2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    107526381 (TGFBR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107526381 (TGFBR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107526381 (TGFBR2)
   05202 Transcriptional misregulation in cancer
    107526381 (TGFBR2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107526381 (TGFBR2)
   05212 Pancreatic cancer
    107526381 (TGFBR2)
   05225 Hepatocellular carcinoma
    107526381 (TGFBR2)
   05226 Gastric cancer
    107526381 (TGFBR2)
   05220 Chronic myeloid leukemia
    107526381 (TGFBR2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107526381 (TGFBR2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107526381 (TGFBR2)
   05161 Hepatitis B
    107526381 (TGFBR2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    107526381 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107526381 (TGFBR2)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     107526381 (TGFBR2)
Protein kinases [BR:mna01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   107526381 (TGFBR2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH
Other DBs
NCBI-GeneID: 107526381
NCBI-ProteinID: XP_016054307
LinkDB
Position
Unknown
AA seq 532 aa
MMITDNNGALKFSQLCKFCDVRSSTCDNQKSCRSNCSITSICEKPNEVCVAVWRKNDENI
TLETVCHDPALVYHGFVLEDAASPQCVMKERKVDGETFFMCSCSSDECNDHIIFSEDYAT
NNPDLLLVILQVTGVSLLPPLCIAISVIIIFYCYRVHRKQKLTPSWETSKPRKLMDLSEH
LAIILEDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVA
VKIFPYEEYASWKMEKDIFSDINLKHENILQFLTAEERKTELGKQYWLITAFHAKGNLQE
YLTRHVISWEDLCKLGSSLARGIAHLHSDHTLCGRPKMPIVHRDLKSSNILVKNDLTCCL
CDFGLSLRLDPTLSVDDLANSGQVGTARYMAPEVLESRMNLENVESFKQTDVYSMALVLW
EMTSRCNAVGEVKDYEPPFGSKVREHPCVESMKDNVLRDRGRPEIPSSWLNHQGIQMVCE
TLTECWDHDPEARLTAQCVAERFSELEHLDRLSGRSCSEEKIPEDGSLGTTK
NT seq 1599 nt   +upstreamnt  +downstreamnt
atgatgatcaccgacaacaatggggcactcaagttttcacaattgtgtaaattctgtgat
gtgagatcttccacctgcgacaaccagaaatcctgcaggagcaactgcagcatcacatcc
atctgtgagaagcccaacgaagtctgtgtggctgtctggaggaagaacgacgagaacata
accctggagaccgtgtgccacgaccccgcgctcgtctaccacgggttcgttctcgaggac
gccgcctccccgcagtgtgtgatgaaggagaggaaagtggacggcgagaccttcttcatg
tgctcctgcagcagtgacgagtgcaatgaccacatcatcttctcagaagactatgccacc
aacaaccccgacttgttgttagtgatactgcaagtgacgggcgtcagcctcctgccgccg
ctgtgtatcgccatatccgtcatcatcatcttctactgctaccgcgttcaccgcaagcag
aagctgacgccgtcctgggagaccagcaagccgaggaagctcatggacctgagcgagcac
ctggccatcatcctggaggacgaccgctccgacatcagctccacgtgcgccaacaacatc
aaccacaacaccgagctgctgcccatcgagctggacacgctggtggggaagggccgcttc
gccgaggtctacaaggccaagctgaagcagaacacttcggagcagttcgagaccgtggcc
gtgaagatcttcccttacgaggagtacgcctcctggaagatggagaaggacattttctcg
gacatcaacctgaagcacgagaacatcctgcagttcttgacggcggaggagaggaagacg
gagctggggaagcagtactggctcatcacggctttccacgccaagggcaacctgcaggag
tatctcacgaggcacgtcatcagctgggaggacctgtgcaagctgggcagctccctggcc
aggggcatagcgcacctgcacagcgaccacaccctgtgcgggaggcccaagatgcccata
gtgcacagggacctcaagagctccaacatcctggtcaagaatgacctcacctgctgcctg
tgtgactttgggctttccctgcgtctggaccccactctctctgtggatgacttggccaac
agcgggcaggtgggaactgcaagatacatggccccagaagtcctagagtccaggatgaat
ctggagaatgtcgagtccttcaagcagacggatgtctactccatggctctggtgctctgg
gagatgacatctcgctgcaatgcagtgggagaagtgaaagactatgagcctccatttggt
tccaaggttcgggagcatccctgcgttgaaagtatgaaggacaatgtgttgagagatcgg
ggacgaccagagattcccagctcctggctcaaccaccagggcatccagatggtgtgtgag
accctgaccgagtgctgggaccacgacccggaggcccggctcacagcgcagtgcgtggcc
gagcgcttcagcgagctggagcacctggacagactctcggggaggagctgctccgaggag
aagattcccgaagatggctcgctgggcactaccaaatag

DBGET integrated database retrieval system