KEGG   Miniopterus natalensis: 107526387
Entry
107526387         CDS       T05883                                 

Gene name
DYNC1LI1
Definition
(RefSeq) cytoplasmic dynein 1 light intermediate chain 1
  KO
K10416  dynein light intermediate chain 1, cytosolic
Organism
mna  Miniopterus natalensis
Pathway
mna04145  Phagosome
mna04962  Vasopressin-regulated water reabsorption
mna05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107526387 (DYNC1LI1)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107526387 (DYNC1LI1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107526387 (DYNC1LI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107526387 (DYNC1LI1)
   03036 Chromosome and associated proteins [BR:mna03036]
    107526387 (DYNC1LI1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mna04812]
    107526387 (DYNC1LI1)
Membrane trafficking [BR:mna04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab4 associated proteins
    107526387 (DYNC1LI1)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     Dynein complex
      107526387 (DYNC1LI1)
Cytoskeleton proteins [BR:mna04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     107526387 (DYNC1LI1)
SSDB
Motif
Pfam: DLIC ABC_tran Roc RsgA_GTPase AAA_16 PduV-EutP G-alpha DUF815 TsaE AAA_7
Other DBs
NCBI-GeneID: 107526387
NCBI-ProteinID: XP_016054315
LinkDB
Position
Unknown
AA seq 524 aa
MAAVGRVSSFGSSPPGLASTYTGGSLANELTSGNGGAAAGDDEDGQNLWSCILSEVSTRS
RSKLPAGKNVLLLGEDGAGKTSLIRKIQGIEEYKKGRGLEYLYLNVHDEDRDDQTRCNIW
ILDGDLYHKGLLKFSLDAISLKDTLVLLVVDMSKPWTALDSLQKWASVVREHIDKLKIPP
EEMKEMEQKLIRDFQEYVEPGEDFPASPQRRNTVSQEDKDNSVVLPLGADTLTHNLGIPV
LVVCTKCDAISVLEKEHDYKDEHFDFIQSHIRKFCLQYGAALIYTSVKENKNIDLVYKYI
VQKLYGFPYKIPAVVVEKDAVFIPAGWDNDKKIGILHENFQTLKAEDNFEDIITKPPVRK
FVHEKEIMAEDDQVFLMKLQTLLAKQPPTAAGRPVDASPRVPGGSPRTPNRSVSSNVASV
SPIPAGSKKIDPNMKAGATSEGVLANFFNSLLSKKTGSPGGPSVGGGSPGAGAGGGSSGL
PPSAKKSGQKPVLSDVHAELDRITRKPVTVSPTTPTSPTEGEAS
NT seq 1575 nt   +upstreamnt  +downstreamnt
atggcggctgtggggcgagtcagctccttcggctcttctccgccgggattagcctcgact
tacacgggcggctccttggccaacgagctaacatcgggcaacggcggcgccgcagcgggc
gacgacgaggacgggcagaacctttggtcctgcatcctcagcgaggtctccacccgctcg
cgatccaagctccccgcggggaagaacgtactgctgctgggtgaagatggagctgggaaa
acaagcttaataagaaaaattcagggaatagaggagtacaagaaagggagaggattggag
tatttgtacttaaatgttcacgatgaagacagggatgatcaaacaagatgtaatatatgg
atcttagatggagatctgtatcacaagggcctccttaagttttcactggatgccatttct
ctgaaggacactctagttctgctggtggttgacatgtcaaagccttggactgctttggat
tctttacagaaatgggcaagtgttgttagagaacatattgacaaattgaaaattcctcct
gaagaaatgaaagaaatggaacaaaagttgattagagactttcaagaatatgtagagcca
ggagaagatttcccagcttctcctcagagaagaaatactgtgtcgcaggaagacaaagac
aacagtgtggttttacccctgggtgcggatacacttacacataacttgggcattccagta
ctagtagtttgcacaaagtgtgatgccattagtgtgttggagaaagagcatgactacaaa
gatgaacattttgattttattcagtcacatatccggaagttttgtttacagtatggtgca
gctcttatttacacttcagtaaaagaaaacaaaaatatagatttagtatataaatacatc
gttcagaaactatatggatttccgtataagattcctgctgttgtggtggaaaaagatgca
gtatttattccagcagggtgggataatgataagaaaataggaatattacatgaaaatttt
caaacattaaaagcagaagataattttgaagacattataactaaaccacccgttcgaaag
tttgtgcatgagaaggaaattatggcagaagacgaccaagtgtttcttatgaagctacag
acccttttagcaaagcaaccaccaactgcagctggcaggcctgtggatgcctcaccaaga
gtcccaggaggctcccctcgaacaccaaacagatcagtgtcgtccaatgttgctagcgtg
tcacccatccctgctggctcaaaaaaaattgatccaaacatgaaagctggagctacaagt
gaaggtgtcctggcaaatttcttcaatagtttgctgagtaaaaagactggttctccagga
ggccccagtgttggtggtggcagccctggagctggggctggaggtggaagtagtggctta
ccaccatctgccaaaaagtcaggccagaagcctgtcctatcagatgttcacgcggaactg
gacagaattacacgaaaaccagttacagtttctcctacaacacccacatctcctacggaa
ggagaagcttcctga

KEGG   Miniopterus natalensis: 107526847
Entry
107526847         CDS       T05883                                 

Definition
(RefSeq) dynein light chain 1, cytoplasmic-like
  KO
K10418  dynein light chain LC8-type
Organism
mna  Miniopterus natalensis
Pathway
mna04962  Vasopressin-regulated water reabsorption
mna05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107526847
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107526847
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mna04812]
    107526847
Cytoskeleton proteins [BR:mna04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     107526847
SSDB
Motif
Pfam: Dynein_light
Other DBs
NCBI-GeneID: 107526847
NCBI-ProteinID: XP_016054938
LinkDB
Position
Unknown
AA seq 114 aa
MASPIGLSLASLPTPPLRRPCSTRTVCDQKVAIKNGDMSEETQQGSVECATQALEKHNIE
KHIVAHIKKDFDKRYNRTWHSIMGENFSSCMTHETKHFIYCYLGQVAILMFKSG
NT seq 345 nt   +upstreamnt  +downstreamnt
atggcttctcccattggtctgagccttgccagcctccccaccccacctctcaggagaccc
tgctccactagaaccgtgtgtgaccaaaaggtggcgatcaaaaatggtgatatgtcggag
gagacgcaacagggctctgtggaatgtgctactcaggcgttggagaagcataacatagag
aagcacattgtggcccatattaagaaggactttgataagaggtacaaccgcacctggcac
agcatcatgggggagaactttagtagttgcatgacacatgaaaccaaacacttcatctac
tgctacctgggccaagtggccattcttatgttcaaatctggttaa

KEGG   Miniopterus natalensis: 107528465
Entry
107528465         CDS       T05883                                 

Definition
(RefSeq) dynein light chain 1, cytoplasmic-like
  KO
K10418  dynein light chain LC8-type
Organism
mna  Miniopterus natalensis
Pathway
mna04962  Vasopressin-regulated water reabsorption
mna05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107528465
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107528465
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mna04812]
    107528465
Cytoskeleton proteins [BR:mna04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     107528465
SSDB
Motif
Pfam: Dynein_light
Other DBs
NCBI-GeneID: 107528465
NCBI-ProteinID: XP_016057034
LinkDB
Position
Unknown
AA seq 84 aa
MVLVIKNAPMSEEMQQDSVECATQALEKYVSYNLEEKKKEFDKKYNPTWHCIMGRNLGSY
VTHETKHFIYFYLGQVAILLFKTG
NT seq 255 nt   +upstreamnt  +downstreamnt
atggtattggtgatcaaaaatgcccctatgtcggaggagatgcaacaggactccgtggaa
tgtgccactcaggcgttggagaaatatgtctcttataatttggaagagaaaaaaaaagag
tttgacaagaagtacaaccccacctggcactgcatcatggggaggaacctcggtagttac
gtgacacatgaaaccaaacacttcatctacttctatctaggccaagtggccattcttctg
ttcaaaactggttaa

KEGG   Miniopterus natalensis: 107528499
Entry
107528499         CDS       T05883                                 

Gene name
DYNLL1
Definition
(RefSeq) dynein light chain 1, cytoplasmic
  KO
K10418  dynein light chain LC8-type
Organism
mna  Miniopterus natalensis
Pathway
mna04962  Vasopressin-regulated water reabsorption
mna05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107528499 (DYNLL1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107528499 (DYNLL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mna04812]
    107528499 (DYNLL1)
Cytoskeleton proteins [BR:mna04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     107528499 (DYNLL1)
SSDB
Motif
Pfam: Dynein_light
Other DBs
NCBI-GeneID: 107528499
NCBI-ProteinID: XP_016057079
LinkDB
Position
Unknown
AA seq 89 aa
MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGR
NFGSYVTHETKHFIYFYLGQVAILLFKSG
NT seq 270 nt   +upstreamnt  +downstreamnt
atgtgcgaccgaaaggcagtgatcaaaaatgccgatatgtcggaggagatgcaacaggac
tcggtggagtgtgctactcaggcgttggagaaatataacatagagaaggatattgcggcc
catattaagaaggagtttgacaagaagtacaaccccacctggcactgcattgtggggagg
aacttcggtagttacgtgacacatgaaaccaaacacttcatctacttctacctgggccaa
gtggccattcttctgttcaaatctggttaa

KEGG   Miniopterus natalensis: 107530249
Entry
107530249         CDS       T05883                                 

Gene name
DYNC1I2
Definition
(RefSeq) cytoplasmic dynein 1 intermediate chain 2 isoform X1
  KO
K10415  dynein intermediate chain, cytosolic
Organism
mna  Miniopterus natalensis
Pathway
mna04145  Phagosome
mna04962  Vasopressin-regulated water reabsorption
mna05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107530249 (DYNC1I2)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107530249 (DYNC1I2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107530249 (DYNC1I2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107530249 (DYNC1I2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mna04812]
    107530249 (DYNC1I2)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     Dynein complex
      107530249 (DYNC1I2)
Cytoskeleton proteins [BR:mna04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     107530249 (DYNC1I2)
SSDB
Motif
Pfam: Dynein_IC2 WD40 ANAPC4_WD40
Other DBs
NCBI-GeneID: 107530249
NCBI-ProteinID: XP_016059452
LinkDB
Position
Unknown
AA seq 632 aa
MSDKSELKAELERKKQRLAQIREEKKRKEEERKKKETDQKKEAVAPVQEESDLEKKRREA
EALLQSMGLTPESPIVPPPMSPSSKSVSTPSEAGSQDSGDGAVGSRTLHWDTDPSVLQLH
SDSDLGRGPIKLGMAKITQVDFPPREIVTYTKETQTPVMAQPKEDEEEDDDVVTPKPPIE
PEEEKTLKKDEENDSKAPPHELTEEEKQQILHTEEFLSFFDHSTRIVERALSEQINIFFD
YSGRDLEDKEGEIQAGAKLSLNRQFFDERWSKHRVVSCLDWSSQYPELLVASYNNNEDAP
HEPDGVALVWNMKYKKTTPEYVFHCQSAVMSATFAKFHPNLVVGGTYSGQIVLWDNRSNK
RTPVQRTPLSAAAHTHPVYCVNVVGTQNAHNLISISTDGKICSWSLDMLSHPQDSMELVH
KQSKAVAVTSMSFPVGDVNNFVVGSEEGSVYTACRHGSKAGISEMFEGHQGPITGIHCHA
AVGAVDFSHLFVTSSFDWTVKLWTTKNNKPLYSFEDNSDYVYDVMWSPTHPALFACVDGM
GRLDLWNLNNDTEVPTASISVEGNPALNRVRWTHSGREIAVGDSEGQIVIYDVGEQVAVP
RNDEWARFGRTLAEINANRADAEEEAATRIPA
NT seq 1899 nt   +upstreamnt  +downstreamnt
atgtcggacaaaagtgaactaaaggcagagttggaacgtaagaagcagcggttggcccaa
atcagagaggaaaagaagagaaaagaagaagaaaggaaaaaaaaggaaactgatcagaag
aaggaagcagttgctcctgtgcaagaagaatcagatcttgagaaaaaaaggagagaagct
gaagcattgcttcaaagcatggggctaactccagaatcccccattgtccctcctcctatg
tctccatcttccaagtctgtgagcacaccgagtgaagctggaagccaagactctggagat
ggcgcagtgggatctaggacgctgcattgggatacagatccatcagttcttcagcttcac
tcagattccgatttgggacgaggacctattaaacttggaatggctaaaattacacaagtt
gactttcctcctcgagaaatcgtgacatatacaaaggaaactcagaccccagttatggct
caacccaaagaagatgaagaagaagatgatgatgtagtgactcctaaaccacctattgaa
cccgaagaagagaaaactttaaagaaagatgaggaaaatgatagtaaagctccccctcat
gagctgactgaagaagaaaagcaacaaatcttgcatacagaagaatttttaagtttcttt
gaccattccacaagaattgtagaaagagctctttctgagcagattaacatcttctttgac
tacagtggaagagatttggaagacaaagaaggagagattcaagcaggtgcaaaactgtca
ctaaatcgacaattttttgacgaacgttggtcgaagcaccgggttgttagttgtttggat
tggtcatctcagtatccagagttactcgtggcttcctataataacaatgaagatgctcct
catgaacctgatggtgtggcccttgtatggaatatgaaatacaaaaaaactaccccagag
tatgtatttcactgccagtcagctgtgatgtctgctacatttgcaaaatttcatccaaat
ctggttgttggtggtacgtattcaggccaaattgtgctatgggataaccgtagcaataaa
agaactccagtgcaaagaactccactgtcagctgctgcacacacacatcctgtatattgt
gtaaatgtcgttggaacacaaaatgctcacaatctaattagcatctctactgatggaaag
atttgttcgtggagtctggacatgctttcccatccacaggatagcatggaattggttcat
aaacagtcaaaggcagtagctgtgacatctatgtctttccctgttggagatgtcaacaac
tttgttgttgggagtgaagaaggctctgtgtacacagcatgccgccatggcagcaaagct
ggaatcagtgagatgttcgaaggacatcaaggaccaatcactggcatccattgtcatgca
gctgttggagcagtagacttctcacatctttttgtcacttcatcatttgactggacagta
aaactatggacaactaagaataacaagcctttatactcattcgaagataattcagactat
gtttatgatgttatgtggtcacccactcacccagccctgtttgcctgtgtggatggcatg
gggaggcttgatttgtggaatctcaataatgacacagaggtgccaactgccagtatttcc
gtggagggtaatcctgctcttaatcgtgtaagatggacccattctggaagagagattgcc
gtgggtgattctgaaggacagattgttatatatgatgtgggagagcaggttgctgtcccc
cgaaatgatgaatgggcacggttcgggcgaacacttgcagaaattaatgcaaaccgggct
gatgcagaagaggaagccgctacccgaatacctgcttag

KEGG   Miniopterus natalensis: 107530351
Entry
107530351         CDS       T05883                                 

Gene name
DYNC2LI1
Definition
(RefSeq) cytoplasmic dynein 2 light intermediate chain 1 isoform X1
  KO
K10417  dynein light intermediate chain 2, cytosolic
Organism
mna  Miniopterus natalensis
Pathway
mna04962  Vasopressin-regulated water reabsorption
mna05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107530351 (DYNC2LI1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107530351 (DYNC2LI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107530351 (DYNC2LI1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mna04812]
    107530351 (DYNC2LI1)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     Dynein complex
      107530351 (DYNC2LI1)
Cytoskeleton proteins [BR:mna04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     107530351 (DYNC2LI1)
SSDB
Motif
Pfam: DLIC Roc Arf
Other DBs
NCBI-GeneID: 107530351
NCBI-ProteinID: XP_016059592
LinkDB
Position
Unknown
AA seq 363 aa
MTNLQQFYQFMPPRNETLWEIAKAEVEKRESNGSEGDGVETGEKSVFFIGSKNAGKTTII
LRCLDRDESPKPTLALEYTYGRKAKGHNTPKDIAHFWELGGGTSLLDLISIPITSDTLRT
FSIVLILDLSKPNDLWPTMENLLQATKSHVDKVIMKLGKTDSKAASALRQKIRSNMQKDH
PDRELIDPFPVPLVIIGSKYDIFQDFDSEKRKVICKTLRFVAHYYGASLMFTSKSEALLL
KIRGVINQLAFGIGKSKSICVDQNKPLFITAGLDSLSHIGSPPVPDNDIGKFNARSPMEL
WKKVYEKLFPPKSVNTLKDIKDPAKDPQYAESEVDEMRIQKDQELEQYKRSSSKSWKQIE
LDS
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgaccaatcttcagcagttttaccaatttatgccccccaggaatgaaactctctgggaa
attgcaaaagctgaagtagaaaaacgggagagtaatggaagtgaaggtgatggagttgaa
actggagaaaaatctgttttcttcattggcagtaaaaatgcgggaaagactactattatt
ctaaggtgtcttgacagggatgagtcaccaaaaccaaccttagctttggaatatacatat
ggaagaaaagcgaaagggcataacacaccaaaagatattgctcacttttgggaactaggt
ggagggacctctttattggacttaatcagcataccgatcacaagtgacaccttaaggaca
ttttctattgttcttattttggatctttccaaacctaatgacctttggcccaccatggaa
aacctgttacaagccacaaaaagccatgtagataaagtgataatgaaactgggaaagaca
gattctaaagcagcttctgcactgagacagaagatacggagtaacatgcagaaggaccat
ccagatcgcgaattaattgacccatttccagtacctctggtcataattggaagtaaatac
gatatttttcaggattttgactctgagaagagaaaggtaatatgcaagacacttcgattt
gttgcacattactatggagcatcgttaatgtttaccagtaaatcagaagctcttttacta
aaaatacgtggagttatcaaccagctggcatttggcattggcaaaagcaaatcaatatgt
gtggatcagaataagccactgtttatcacggcaggattggattctttaagtcatatagga
tcacctcctgttcctgataatgacattggaaagtttaatgcccgttcaccaatggaactg
tggaaaaaagtgtatgagaagctcttcccaccaaagagtgtcaacacactgaaagatatc
aaggaccctgcaaaagaccctcagtatgctgaaagtgaagttgatgaaatgagaattcag
aaggatcaggaactggaacagtacaaaagaagttcttccaagtcttggaaacagattgag
ctggattcttga

KEGG   Miniopterus natalensis: 107532412
Entry
107532412         CDS       T05883                                 

Gene name
DYNC2H1
Definition
(RefSeq) cytoplasmic dynein 2 heavy chain 1 isoform X1
  KO
K10414  dynein heavy chain 2, cytosolic
Organism
mna  Miniopterus natalensis
Pathway
mna04145  Phagosome
mna04962  Vasopressin-regulated water reabsorption
mna05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107532412 (DYNC2H1)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107532412 (DYNC2H1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107532412 (DYNC2H1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107532412 (DYNC2H1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mna04812]
    107532412 (DYNC2H1)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     Dynein complex
      107532412 (DYNC2H1)
Cytoskeleton proteins [BR:mna04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     107532412 (DYNC2H1)
SSDB
Motif
Pfam: AAA_6 DHC_N2 AAA_9 AAA_8 Dynein_C AAA_lid_11 AAA_5 DHC_N1 Dynein_heavy AAA_7 MT AAA_22 AAA_16 RsgA_GTPase ABC_tran AAA AAA_24 AAA_30 Laminin_I RNA_helicase AAA_18 AAA_28 AAA_29 ATPase_2 ERM AAA_21 AAA_33 AAA_23
Other DBs
NCBI-GeneID: 107532412
NCBI-ProteinID: XP_016062224
LinkDB
Position
Unknown
AA seq 4313 aa
MAGGTEDVRKLFIFTTAQNYFGLAPGAWDQPLLYHSPEINNFLDDGNQMLLRVQRCDDAL
ISLSNAIDSADTKDKVLVFFKLRPEVITDQNLHNNILVSSMLESPINSLYQAVRQVFAPM
LLKDQEWSRNFDPKLQNLLSELEAGLGVVLRRSDTNLSKLKFKEDDTRGILTPNDEFQFW
IEQAHRGNKQISKERAIYFKELFETISREFYNLDTLSLLEVVDLVETTRDVVDDVWRQTE
HEHYPESRMLHLLDIIGGSFGRFVQKKLGTLNLWEDPYYLVKENLKAGISICEQWVIACN
HLTGQVWQRYVPHQWKNEKYFPETLDKLGKRLEEVLAVRTIHEKLLYFLPASEEKTLARV
FEPFTGLNSVQYNPYTEPLWKAAVSQYEKIIVPVERKIAGKLKNYISEIQDSPQQLLQAF
LKYKELVKRPIISKELMLERETLLARLVDSVKDFRSDFENRSRGVPGDASGPLSGKNLSE
VVNNIVWVRQLELKVDDTIKIAEAVLSDLSGFRSFHRNAEDLLEQFKLYEQEQFDDWSRD
IQSGLSDSRSGLCIEANSRIMELDPNDGSLKVHYSDRLVILLREVRQLSALGFVIPAKIQ
QVANIAQKFCKQAIILKQVAHFYNSIDQQMIQSQRPMMLQSALAFEQIIKNSKAGSGGKS
QITWDNPNELEGYIQKLQSAADRLATENRKLRKWHTTFCEKVVILMNIDLLRQQQRWKDG
LQELRTGLASVEAQGFQASDMHAWKLHWNHQLYKALEHQYQMGLEALNENLPEINIDLMY
KQGRLQFRPPFEEIRAKYYREMKRFIGIPNQFKGVGEAGDESIFSIMIDRNASGFLTIFR
KAEDLFRRLSAVLHQHKEWIVVGQVDMEALVEKHLSTVHDWEKNFKALKIKGKEAERLPS
AVKVDCLNINCSPVKTVIDDLIQKLFDVLVLSLKKSVQAHLHEIDTFVTEAMEVLSIMPQ
SVEEIGNANVQYSKLQEQKPEILPLFQEAEDKNRLLRTVAGGGLETISNLKAKWDKFELM
MESHQLMIKDQVEVMKGNVKSRLQIYNHELEKFKARWDQLKPSDDVIDTGQPNTLDESAK
LIKEKKIEFDDLEVIRKKLIDDCHHFGLEEPNFSLAYSISKDIESCAQIWALYEEFQQGF
QEMANEDWITFRTKTYLFEEFLMNWHDRLRKAEEHSVMTVKLQSEVDKYKIVIPILKYVR
GEHLSPDHWLDLFRLLGLPRGTSLEKLLFGDLLRSADTIVAKASDLKDLNSRAQGEVTIR
EALRELDLWGVGAVFTLTDYEDSQRRTIKLIKDWKDIVNQVGDNRCLLQSLKDSPYYKGF
EDKVSIWERKLAQLDEYLQNLNHIQRKWVYLEPIFGRGALPKEQARFNRVDEDFRSIMTD
IKKDNRVTTLTTHAGIRNSLLKILDQLQRCQKSLNEYLEEKRSAFPRFYFIGDDDLLEIL
GQSTNPSVIQSHLKKLFAGINSVCFDKESKHIIAMKSLEGEVVPLKNKVLLSNNVETWLN
DLALEMKQTLKQLLTECVTAGRSSRGAIDSSLFPSQILCLAEQIKFTEDVENAIQDHSLH
QIETQLVNKLEHYTDVDTSSEDSGNTESGIMELKLKALILDIIHNIDVVKQLNQAQVHTT
EDWAWKKQVRFYMKSDDICYVQMVDTELQYTYEYQGNAPKLVYTPLTDKCYLTLTQAMKM
GLGGNPYGPAGTGKTESVKALGGLLGRQVLVFNCDEGIDVKSMGRIFVGLVKCGAWGCFD
EFNRLEEAVLSAVSMQIQTIQDALKNHRTVCELLGKEVEINSNSGIFITMNPAGKGYGGR
QKLPDNLKQLFRPVAMSRPDNELIAEVILYSEGFKDAKVLGRKLVAIFNLSRELLTPQQH
YDWGLRALKTVLRGSGNLLRQLKKSSVKQKINESHIVVQALRLNTMSKFTFADCTRFDAL
IKDVFPGIDFKDVEYDELSAALKQVFEEANYEIIPNQIKKALELYEQLRQRMGVVIVGPS
GAGKSTLWRMLRTALLKIGKVVKQYTMNPKAMPRHQLLGHIDMDTREWSDGVLTNSARQV
VREPQDVSSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFVFETHDLSC
ASPATISRMGMIFLSDEETDINSLIKSWLRNQPPKYRNNLENWIGDYFEKALQWVLKQND
YVVETSLVGTVMNGLSHLHGCKDHDQFIINLIRGLGGNLNMKSRLEFTKEVFNWARESPP
DAHKPMDTYYDSSQGRLASYVLKKPENLTADDFSNSQTLPVIQTPDMQRGLDYFKPWLSS
NTKQPFILVGPEGCGKGMLLRYAFSQLRSTQIATVHCSAQTTSRHLLQKLSQTCMVISTN
TGRVYRPKDCERLVLYLKDINLPKLDKWGTSTLVAFLQQVLTYQGFYDENLEWVGLENIQ
IVASMSAGGRLGRHKLTTRFTSVVRLCAIDYPEREQLQTIYGAYLEPVLHKNLKNHSIWG
SSSKISLLAGSMVQVYEQVRAKFTVDDYSHYIFTPCILTQWVLGLFRYDLEGGPSHHPLD
YVLEIVAYEARRLFRDKIVGAKELHLFDNILMSVLQGDWGSDILDNMADSFYVTWGARHD
SGTRAAPGQPLPPHGKPLGKLNSADLKDVIKKGLIHYGRDNQNLDILLFQEVLEYMSRID
RVLSFPGGSLLLAGRSGVGRRTITSLVSHMHGAVLFSPKISRGYELKQFKNDLKHVLSLA
GIEAQQVVLLLEDHQFVHPAFLEMINSLLSSGEVPGLYTLEELEPLLVPLKDQASQDGFF
GPTFNYFTYRIQQNLHIVLIMDSANLNFIINCESNPALHKKCQVLWMEGWSDSSMKKIPE
MLFNETGSEEKHGDKKRKEEKKKYSVDPDFLKSFLLIHESCKAYGATPSRYMTFLHVYSA
ISSSKKKELLKRQSHLQAGVSKLNEAKALVDELNRKAGEQSVLLKIKQGEADAALQEITV
SMQDASEQKTELERLKHRIADEVVKIEERKNKIDDELKEVQPLVNEAKLAVGNIKPESLS
EIRSLRMPPDVIRDILEGVLRLMGIFDTSWVSMKSFLAKRGVREDIATFDARNIPKEIRE
SVEELLFKNKGSFDPKNAKRASTAAAPLAAWVKANVQYSHVLERIQPLETEQGRLESNLK
KTEDRKRKLEELLNSVGQKVSELKEKFQSRTSEAAKLEAEVSKAQETIKAAEVLINQLDR
EHKRWNAQVAEITEELATLPKRAQLAAAFITYLSAAPEGLRKTCLEEWTKSACLEKFDMR
RFLCTESEQLIWKSEGLPSDDLSIENAIVILQIIGLKSWSRVCPFLIDPSSRATEWLKTH
LKDSRLEVINQQDSNFITALELAVRFGKTVIIQEMDGVEPVLYPLLRRDLVAQGPRYVVQ
IGDKIIDYNEEFRLFLSTRNPNPFIPPDAASIVTEVNFTTTRSGLRGQLLALTIQHEKPD
LEEQKTKLLQQEEDKKIQLAKLEESLLETLATSQGNILENKDLIESLNQTKASSALIQES
LKESYKLQIFLDQERDAYLPLAESASRMYFIISDLSKINNMYRFSLAAFLRLFQRALQNK
QDSENTEQRIQSLISSLKQMVYDYVCRCLFKADQLMFALHFVRGMHPEHFQENEWDTFTG
VVVGDMLRKADSQQRIRDQLPSWIDQERSWAVATLKIALPGLYQTLCLEDAALWRTYYHH
SMCEQEFPSILAKKVSLFQQVLVVQALRPDRLQSTMALFACRTLGLKELSPLPLNLKRLY
KETLEFEPILIIISPGADPSQELQELANAERSGGCYHQVAMGQGQADLAIQMLKECARNG
DWLCLKNLHLVVSWLPVLEKELNTLQPKDTFRLWLTAEVHPNFTPILLQSSLKITYESPP
GLKKNLMRTYESWTPEQISKNGNVRRAHALFSFAWFHAACQERRNYIPQGWTKFYEFSLS
DLRAGYNIIDRLFDGTKDVQWEFVHGLLENAIYGGRIDNYFDLRVLQSYLKQFFNSSIID
VLNQRNKTSIFPYSLSLPKSCSILDYRAVIEKLPEDDRPSFFGLPANIARSSQRMISSQV
ISQLRILGRSVTAGCKFDREIWSNELSPVLNLWKKLNQNSNLIHQKVPPPSDRQGSPILS
FIVLEQFNAIRLVQSVHQSLAALSKVIRGTTLLSSEVQKLASALLNQKCPLTWQSKWEGP
EDPLQYLRGLVSRALAIQSWVEKAEKQTLLSDTLDLSELFHPDTFLNALRQDTARAVGCS
VDSLKFVASWKGRLQEAKLQIKVSGLSLEGCSFDGNQLSENQHDSPSVSSVLPCFMGWIP
QGAYGPYSPDECISLPVYTSAERDRVVTNIDVPCGGSQDQWIQCGAALFLKNQ
NT seq 12942 nt   +upstreamnt  +downstreamnt
atggcgggcgggaccgaggacgttcggaagctgttcatcttcaccacggcgcagaattac
ttcgggctggcgccgggagcctgggaccagccgctgctgtaccacagtcccgagatcaac
aacttcttggacgacgggaaccagatgctcctccgggtgcagcgctgcgacgacgccctg
atctccttgtctaacgcgattgattctgctgacacaaaggataaagtgttggtgtttttc
aagctgcgacctgaagtgattacagatcagaatctacataacaacattcttgtttcctct
atgttagaatcacctataaattccctttatcaggcagtacggcaggtatttgcaccaatg
ctgttaaaggatcaggaatggagcagaaactttgatcccaaacttcagaatcttttgagt
gaactagaagctggattgggtgtggttctacgaagatcagacactaatttatcaaaattg
aaatttaaggaagatgacacacgaggtattcttacaccaaatgatgagttccagttttgg
atagaacaagctcatcgtggaaataaacagattagtaaagaaagagccatttattttaaa
gaattatttgaaacaatctcaagagagttttataacttggacactctatccttactggaa
gtcgttgacttggtagagactactcgggatgttgtcgatgacgtgtggagacaaacagag
catgagcattatcctgagtcacgaatgttacatctcttagatatcataggtggttcattt
ggaagatttgttcagaaaaagttgggaactttgaacctatgggaagatccttattatctt
gtgaaagaaaatctgaaagctggtatttcaatttgtgagcagtgggtgatcgcctgtaat
catctaacaggtcaggtgtggcagcgctatgttcctcatcagtggaaaaatgaaaaatac
ttccctgaaacacttgacaaacttggcaaacgccttgaagaggtcttagctgttagaaca
attcatgagaagcttctctattttttacctgctagtgaagagaaaaccctggctcgagta
tttgaaccttttactggcctgaattcagtgcaatacaatccatatactgagcctttatgg
aaagctgcagtgtctcaatatgaaaaaattattgtacctgtggaacgaaaaatagcagga
aaattgaaaaattatatttcagaaattcaagatagtccacagcagcttcttcaagcattt
ctgaaatataaagagttggtgaagcgtccaattataagcaaagaattgatgttagaaaga
gaaactttactggcaaggcttgtggactcagttaaagattttcgatcagactttgagaat
cgaagccgaggagttcccggtgatgcatccggaccactttctggcaaaaacctttcagaa
gttgtcaataatatagtttgggttcgccagttggaactgaaggtggatgataccatcaag
atagcagaggctgttttgtctgacttgtcaggatttcggtctttccatcgaaatgctgaa
gatctcttagagcagtttaaactgtacgaacaagagcaatttgatgattggtccagggac
attcagtctggtttgtctgattctagatcgggtttgtgtattgaggctaatagtagaatt
atggaactagatcctaacgatggctcattaaaagtgcattattcggatcggctggtgatt
cttctgagagaagttcgtcagctttctgcacttggctttgtcattcctgccaaaatacag
caagttgcaaacattgcacagaaattctgcaagcaagcgattattcttaaacaagtggca
catttttacaattctatcgatcaacaaatgattcaaagtcagaggccaatgatgttacaa
tctgccttagcatttgaacagataattaagaattctaaagcaggaagtgggggaaagtca
cagattacttgggataatcctaatgaattagaaggctacattcagaaactacagagtgct
gctgaccgacttgccactgagaatagaaaactgagaaaatggcacactacattttgtgaa
aaggtggtaattcttatgaatattgatctgcttcggcagcagcagcgttggaaagatgga
ttacaagaattgagaactggcttagcaagtgtagaagcacagggattccaagcaagtgac
atgcatgcgtggaaactgcactggaatcatcagctgtacaaagctctggagcatcagtat
cagatgggcttagaagcacttaatgagaatctgccagaaataaatattgacttaatgtac
aaacaaggacggttacaattccggcctccttttgaagagatccgggctaaatattacaga
gaaatgaagaggtttatcggcattcctaatcagtttaagggagtgggggaggcaggagat
gaatctattttttctattatgattgatagaaatgcaagtggatttctgactattttcaga
aaagcagaagatctatttaggagattgtcagctgttttacaccaacataaggaatggatt
gtagttgggcaagttgatatggaagctctagtggaaaagcatctctctactgttcatgat
tgggaaaaaaattttaaagcactgaaaataaaaggaaaagaggcagaacgacttccaagt
gctgtcaaggtggactgcttaaatattaattgcagccctgtgaagactgtgattgatgac
ctcatccaaaagttatttgatgtgctggttctttctttgaagaagtctgtccaggctcat
ttacatgaaattgatacatttgtcactgaagctatggaagtcttatcgattatgccccag
tctgtggaagagataggtaatgcaaatgtgcagtatagtaagctacaggaacagaagcca
gagattttgcctttatttcaagaagctgaagataaaaatagacttttacgaactgtggca
ggtggaggtttagaaacaattagcaatctgaaggctaaatgggataaatttgagctgatg
atggaaagtcaccaacttatgattaaagatcaggttgaagtgatgaaaggaaatgtgaaa
tcacgtcttcagatctataatcatgaattggaaaaatttaaagctcgttgggaccaacta
aagcccagtgatgatgttattgacactggccagccaaatacccttgatgaaagtgcaaag
ttaataaaagagaaaaaaattgagtttgatgatcttgaagtcataagaaaaaagctgatt
gatgattgccatcattttggactagaagagcccaacttctctttggcatatagcatctct
aaagacattgagagctgtgcacaaatttgggcgctttatgaagagtttcagcaaggattt
caggaaatggccaatgaagattggattacttttcggactaagacatatctgtttgaggaa
tttttgatgaattggcatgacagattaaggaaagctgaagaacattcagtaatgacagtg
aaattacaatcagaagttgacaagtataaaattgtaattcctatcttgaaatatgtgaga
ggggagcatctttctccagatcactggcttgacctttttcgtctacttggccttcctagg
gggactagtctagagaaattattgtttggtgatcttctcagatcagctgatacaattgtt
gccaaagcttcagaccttaaagatttaaatagtcgggcacaaggtgaagttacaatcaga
gaagctttacgtgaacttgatctttggggagttggagcagtgtttacattgactgattat
gaagacagccaaagacgaaccatcaagctgattaaagactggaaagatatagtaaaccaa
gttggagataatagatgccttcttcaatccttaaaggattctccttattataaaggattt
gaagataaagtgtcaatttgggaaagaaaacttgcacagttagatgagtacctgcagaat
ttaaaccacattcagagaaagtgggtgtatctggaacccatttttggccgtggagcattg
ccaaaagaacaggcacgcttcaacagagtggatgaagactttagatcaataatgactgac
atcaagaaagacaacagagtcacaacattaaccactcatgcaggaatcagaaattctcta
ctaaaaatacttgatcaacttcaaagatgtcagaaatcattaaacgaatatttggaggaa
aaacgctcagcatttccaagattttattttattggtgatgatgatttgttagaaatactg
ggccagtcgaccaatccttcagtaattcagtctcaccttaagaaactgtttgctggtatt
aatagtgtgtgttttgataaggaatcaaaacatataattgcaatgaaatctttagaggga
gaagttgtacctttaaaaaataaagttcttctgtcaaataatgtagagacgtggctaaat
gatttggccttggaaatgaagcaaactttgaaacagttgttgacagaatgtgttacagct
ggtcgaagttctcgaggtgcaattgactcatcgctgttcccttcgcagatattatgcttg
gcggagcagattaaatttactgaagatgtagaaaatgctatccaagatcatagtcttcat
cagattgaaacacaactggtgaacaagttagagcactatactgacgtggataccagttcc
gaggactcgggcaatactgaatctggcatcatggagcttaagcttaaagcactaatcctt
gacattattcataatattgatgtggtgaaacaattgaaccaagctcaagttcatacaact
gaagactgggcttggaaaaaacaagttagattctatatgaaaagtgatgacatatgttat
gttcaaatggtggatactgaacttcagtatacttacgagtatcagggtaatgctcccaag
ctggtatatactccactgacagacaagtgctacctaactctcactcaagccatgaagatg
ggacttggaggaaatccttatggaccagctggaactggaaaaactgaatcagtcaaggct
ttgggtggacttcttggaagacaagttttagtttttaattgtgatgagggcattgatgtg
aagtcaatgggacgaatatttgttggtttggtcaagtgtggggcgtggggttgttttgat
gaattcaatagactggaagaagctgtactgtctgcagtttctatgcagatccagacaatt
caagatgctttgaagaatcatagaactgtatgtgaactgcttggcaaggaggtagaaata
aattctaattctggaatttttatcactatgaatcctgctggaaaaggttacggaggaaga
caaaagctgcctgataatcttaaacagcttttcaggccagtagccatgtctcgtccagac
aatgagctgatcgcagaagtcattctctattcagaaggctttaaagatgctaaagtattg
ggcaggaaattggttgctatcttcaatctatctagggaacttttgacacctcaacaacat
tatgactggggtttgagagctttgaagacagttctgagaggaagcggaaatcttcttaga
caactgaagaaatccagcgttaaacagaaaattaatgaaagtcatattgtggtgcaagca
ttgaggcttaatacaatgtcaaagtttacatttgctgattgcactcggtttgatgcgctg
atcaaagatgtgtttcctggaattgactttaaagacgtagaatatgatgaactgagtgct
gcattaaagcaagtctttgaggaggccaattatgaaatcatacccaaccagatcaagaag
gctttagaactgtatgaacaattacgccagaggatgggagttgttattgttggtccaagt
ggtgctggaaaatcaactctttggagaatgctaaggacagcacttcttaaaattggcaaa
gtggtgaaacaatataccatgaatcccaaagctatgcctagacatcagttattaggccat
attgacatggatacgagggaatggtctgatggtgttttgacaaatagtgctcgccaagta
gttcgagaacctcaagatgtcagctcatggataatctgtgatggcgatattgatcctgag
tggatagagtctctgaattccgttctggatgataaccgactgctcactatgcccagtgga
gaaaggattcagtttggcccaaatgttaactttgtatttgaaactcatgatttgagttgt
gcttcgccagccacaatatctagaatgggaatgatctttcttagtgatgaagagacagat
attaattctctgataaaatcttggttgaggaatcagcctcctaaatacaggaataacctt
gaaaactggattggagattatttcgaaaaagctttacagtgggttctaaagcagaatgac
tatgtggtggaaacaagtttggttgggactgtgatgaatggtttgtcacatctacatgga
tgcaaagatcatgaccaatttattattaatctcataaggggacttggtggaaatctgaac
atgaaatcacgtctggaattcaccaaagaggtttttaattgggcgcgagaatctcctcca
gatgctcacaaaccaatggacacctactatgactcgagtcaaggacgattagcgtcttac
gttctgaagaagccagaaaacttgactgctgatgatttcagtaatagccaaacacttcca
gtcattcagactcctgacatgcagcggggtctagattatttcaaaccgtggttaagttct
aacactaaacagccatttattcttgtgggaccagaaggatgtggcaaagggatgctgctc
aggtatgccttttcccaactccggtccactcagattgctacagttcactgtagcgcacaa
acaacgtctcgacatctcctgcagaaactgagccaaacttgcatggtaatcagtactaat
actggccgagtatacagacccaaagactgtgaaagacttgttttgtacttaaaagatatc
aacctacccaaacttgataaatgggggaccagtactttggtagcgttcctacaacaggta
ttgacatatcaaggattttatgatgaaaatttggaatgggttggtttagaaaatattcag
attgtggcttctatgtcagctggcggaagactaggaagacataaactcaccaccagattt
acttctgttgttcgtctttgtgctatagattacccagaaagagagcaattacagacaatt
tatggagcatatttggaaccagttttacataaaaatttgaagaatcattctatttggggt
tcttcatcaaaaatttctctcttagcaggatctatggtacaagtgtatgaacaggtgcgg
gccaaatttacagttgatgattatagtcactatatttttactccttgcattcttacccag
tgggttcttggcttattcagatatgatttagaaggaggaccttcacaccatccgctagat
tatgtattagaaatcgtagcatatgaagcaaggcgcttatttcgtgacaaaattgttggt
gcaaaggaacttcatttatttgacaacattttaatgtcagtgcttcaaggagattggggg
tcagatatactagacaacatggcagatagtttctatgttacatggggagcccgacatgat
tcaggaacaagggcagccccaggacagccattgcctccacatggaaaaccacttggaaaa
ctaaattctgcagatctcaaggatgttattaaaaagggtcttattcattatggacgtgat
aaccagaatttagatattttactttttcaagaagtcctggaatatatgtctcggatagat
agagtgctgagcttccctggaggttcacttctgttagcaggacgcagtggcgtaggccgt
cggactatcacttctttagtcagtcatatgcatggagcggtgctgttttccccaaagatc
tccagaggatatgaactcaagcagttcaaaaatgatctcaaacatgtgctgagtcttgca
gggattgaagcacagcaggtggttttgcttcttgaggatcaccagtttgtgcaccctgca
tttttggagatgatcaatagccttctgtcttcaggtgaagttcctggactctatactctt
gaagaattagagcccttgctggtgcctctcaaggatcaggcttcacaggatggatttttt
ggaccaaccttcaattacttcacatatagaattcaacaaaacttgcatattgtcttgata
atggattctgcaaatttaaacttcataataaactgtgagagtaatccagcattgcataag
aaatgccaggtgttgtggatggagggttggtcagatagcagcatgaagaaaatacctgaa
atgttatttaatgaaacaggtagtgaagaaaaacatggtgacaaaaaaagaaaagaagaa
aagaaaaaatattcagttgatcctgactttttaaaatcatttttattaattcacgaatct
tgtaaagcatatggcgctacaccaagcagatacatgacctttctacatgtgtattctgcc
attagtagcagcaagaaaaaggaattattaaaaagacaaagtcatttgcaggctggtgta
tctaaactaaatgaagctaaagctcttgtggatgaactgaacagaaaagctggagaacaa
agtgtattacttaaaattaagcagggtgaagcagatgctgcccttcaagagatcacagtg
tcaatgcaggatgctagtgagcaaaagacagaacttgaaagactgaagcacagaatagca
gatgaagttgttaaaattgaagagagaaaaaacaaaattgatgatgaattaaaagaagta
cagcctctagtgaatgaagccaaactagcagttggaaacattaagccagaatctctttca
gaaattcgctcactgcgcatgccacctgatgtgatcagagacattcttgaaggagtttta
aggttgatgggtatctttgatacatcttgggtgagcatgaaaagtttccttgcaaaaaga
ggtgtgagagaagacatagcaacctttgatgcacgaaatattccaaaggaaataagagag
agtgttgaagaacttctttttaaaaataaaggatcttttgatccaaagaatgccaagcgt
gccagcacagcagcggctcctttggctgcctgggtgaaagccaatgtgcagtactcccac
gtcctggaacgaattcagcctttggaaactgagcaggggcgattagaatcaaatttgaag
aaaactgaagacagaaaaaggaaactagaggagcttcttaattctgttggtcaaaaagta
tcagaactcaaagagaaatttcagagcaggacttcagaggctgcaaaacttgaggctgaa
gtaagcaaagcacaagaaacaattaaagctgcagaagtcttaattaatcagcttgataga
gaacacaagagatggaatgcacaggttgcagagataacagaggaattagctactcttcct
aaaagagctcaactggctgctgcatttattacatacctttctgctgctcctgagggtctg
aggaaaacctgtttggaagaatggaccaagtcagcttgtcttgaaaaatttgatatgagg
aggtttctttgtactgaaagtgagcagttaatttggaaaagtgaaggcctaccatcagat
gatctttccatagaaaatgctattgttatcttacagatcattggtttgaaatcatggagt
cgagtatgcccatttcttatagacccttcttcccgagctacagaatggttaaaaacacat
ttgaaagactcgcgtttggaagttattaaccagcaggatagtaactttatcacagctctc
gagttggcagtacgttttgggaaaactgttattatacaagagatggatggtgtagaacct
gttctttatccattattgagacgagatctggttgctcaaggaccacgttatgtggtacaa
ataggtgacaaaattattgactacaatgaagaattccgcctttttttgtcaacaagaaac
ccaaatccctttattccaccggatgcagcttccattgttactgaggttaactttaccacg
accagaagtggattacgaggacagcttttggctttaactattcagcatgaaaaacctgat
ttagaggaacagaaaacaaaactattgcaacaggaagaagataagaaaatacagttagcc
aagcttgaggaatctctcttagagacacttgccacatctcaaggcaatattttggaaaat
aaggatttgattgaatctttgaatcagacaaaagcaagcagtgcacttattcaagagtcc
cttaaagaatcttacaaactccagatttttcttgatcaagagcgggatgcctatcttcct
ctggcggagagtgccagcaggatgtacttcattatctctgacttgtccaaaattaataac
atgtaccgttttagtttggctgcatttcttcgacttttccagcgagctctgcagaacaaa
caggattctgaaaacacagaacagcgaatccagtctcttatcagctcattaaaacagatg
gtatatgactatgtatgccgttgtctatttaaggctgatcagctgatgttcgcgttgcat
tttgtccgaggcatgcatcctgaacattttcaagaaaatgaatgggatacatttacaggt
gtggttgttggagacatgttgcggaaagctgactcgcaacaaagaatacgtgaccagctt
ccctcttggatagaccaggaaaggagctgggcagtggcgacgttaaagattgctctcccc
gggctttatcagaccctctgccttgaagatgcagctctgtggcgtacttactatcatcat
tcaatgtgtgagcaagagtttccatctattcttgcaaagaaagtttccttatttcagcag
gttcttgtggtgcaggctctcagaccagacaggctgcagagcaccatggctctgttcgca
tgcaggactctgggactgaaagagttgtccccccttcctctaaatctcaaacgtttgtac
aaagagacactagaatttgaacccatcttgataattatttctccgggtgctgatccttct
caggaacttcaggaacttgctaatgctgaaagaagtggagggtgttatcaccaggttgcc
atggggcaaggtcaagctgatttagcaattcagatgctaaaagaatgtgctcgcaatgga
gattggctctgtttgaagaacttacatcttgtggtatcttggctgccagttctggaaaag
gagttgaatactcttcaacctaaagacacctttcgtctttggctcactgcagaagttcac
cccaactttactcctattttattacagtcaagtttgaagataacatatgagtcacctcca
ggtttgaagaagaatttaatgcgtacttatgaatcttggactcctgagcaaattagcaaa
aatggcaatgtacgtcgagctcatgctctcttcagttttgcatggtttcatgctgcatgt
caagaaagaagaaattatatcccacagggttggaccaaattttatgagttttctttgtca
gatcttcgtgctgggtacaacattattgacaggctctttgatggtaccaaagatgtacaa
tgggaatttgtacatggtctccttgaaaatgctatttatggaggacgtatagataactat
tttgaccttagagttcttcagtcatacctgaaacagttctttaattcttcaataattgat
gtattaaaccaaaggaacaagacaagcatttttccatattccttatctctgcccaaatcc
tgcagcatcttggactatcgtgctgtcattgaaaaactccccgaggatgacagacctagc
ttctttggtctgcctgccaacattgctcgctcatctcagcgcatgatcagttctcaggtt
atttcacagttgagaatcttgggcagatcagtaacagctggttgcaaatttgatagagaa
atctggtctaatgaactttctcctgtccttaatctctggaagaaactaaaccagaactca
aacctcattcatcagaaagtgcctcctcctagtgaccggcagggatctccgatattatca
ttcatcgttcttgaacagtttaatgccattcgcttagtacaaagtgttcatcagtctctt
gccgctctcagcaaagtcatcagaggaacgaccttattgagttcagaagtacaaaaattg
gcaagtgctttattaaaccaaaagtgccctctcacatggcagagcaagtgggaaggccca
gaagaccccttacagtacctcagaggtcttgtatctcgtgcacttgcaatacagagctgg
gtagagaaagcagaaaaacagactcttctctccgacacacttgacctatcagagctcttc
cacccagacaccttcctcaatgcccttcgccaggacactgcaagggccgtgggctgttct
gtggatagccttaaatttgtagcctcatggaaaggtcgactgcaagaagcaaagctgcag
attaaggttagtggcttatccctagaaggatgcagttttgatggaaatcaactttctgaa
aaccagcatgattctcctagtgtatcctcagttctcccttgttttatgggatggattcca
cagggtgcatacggcccatattcccctgatgagtgcatatctctgcctgtttacacaagt
gctgagagggaccgtgtggtgaccaacatcgacgttccatgtggaggcagccaagaccag
tggattcagtgtggagcagctctgtttctgaaaaaccagtag

KEGG   Miniopterus natalensis: 107535267
Entry
107535267         CDS       T05883                                 

Gene name
DYNLL2
Definition
(RefSeq) dynein light chain 2, cytoplasmic
  KO
K10418  dynein light chain LC8-type
Organism
mna  Miniopterus natalensis
Pathway
mna04962  Vasopressin-regulated water reabsorption
mna05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107535267 (DYNLL2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107535267 (DYNLL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mna04812]
    107535267 (DYNLL2)
Cytoskeleton proteins [BR:mna04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     107535267 (DYNLL2)
SSDB
Motif
Pfam: Dynein_light Nop Ectatomin
Other DBs
NCBI-GeneID: 107535267
NCBI-ProteinID: XP_016066132
LinkDB
Position
Unknown
AA seq 89 aa
MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGR
NFGSYVTHETKHFIYFYLGQVAILLFKSG
NT seq 270 nt   +upstreamnt  +downstreamnt
atgtctgaccggaaggcagtgatcaagaacgcagacatgtctgaggacatgcaacaggat
gccgttgactgcgccacacaggctatggagaagtacaatatagagaaggacattgctgcc
tatatcaagaaggaatttgacaagaaatacaaccctacctggcattgtattgtgggccga
aattttggcagctacgttacacacgagacaaagcacttcatctatttttacttgggtcaa
gttgcaatcctcctcttcaagtcaggctag

KEGG   Miniopterus natalensis: 107536492
Entry
107536492         CDS       T05883                                 

Gene name
DYNC1H1
Definition
(RefSeq) cytoplasmic dynein 1 heavy chain 1 isoform X1
  KO
K10413  dynein heavy chain 1, cytosolic
Organism
mna  Miniopterus natalensis
Pathway
mna04145  Phagosome
mna04962  Vasopressin-regulated water reabsorption
mna05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107536492 (DYNC1H1)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107536492 (DYNC1H1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107536492 (DYNC1H1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107536492 (DYNC1H1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mna04812]
    107536492 (DYNC1H1)
   04147 Exosome [BR:mna04147]
    107536492 (DYNC1H1)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     Dynein complex
      107536492 (DYNC1H1)
Cytoskeleton proteins [BR:mna04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     107536492 (DYNC1H1)
Exosome [BR:mna04147]
 Exosomal proteins
  Proteins found in most exosomes
   107536492 (DYNC1H1)
SSDB
Motif
Pfam: DHC_N1 AAA_6 DHC_N2 AAA_9 AAA_8 Dynein_C AAA_7 AAA_lid_11 MT AAA_5 Dynein_heavy Dynein_AAA_lid AAA AAA_33 AAA_22 AAA_18 Mg_chelatase T2SSE AAA_19 AAA_lid_1 AAA_25 IstB_IS21
Other DBs
NCBI-GeneID: 107536492
NCBI-ProteinID: XP_016067699
LinkDB
Position
Unknown
AA seq 4583 aa
MTFPGSRSSVAAFAGTSQGESEEDVGDEGEEEKEFISYNINIDIHYGVKSNSLAFIKRTP
VIDADKPVSSQLRVLTLSEDSPYETLHSFISNAVAPFFKSYIRESGKADRDGDKMAPSVE
KKIAELEMGLLHLQQNIEIPEISLPIHPIITNVAKQCYERGEKPKVTDFGDKVEDPTFLN
QLQSGVNRWIREIQKVTKLDRDPASGTALQEISFWLNLERALYRIQEKRESPEVLLTLDI
LKHGKRFHATVSFDTDTGLKQALETVNDYNPLMKDFPLNDLLSATELDKIRQALVAIFTH
LRKIRNTKYPIQRALRLVEAISRDLSSQLLKVLGTRKLMHVAYEEFEKVMVACFEVFQTW
DDEYEKLQVLLRDIVKRKREENLKMVWRINPAHRKLQARLDQMRKFRRQHEQLRAVIVRV
LRPQVTAVAQQNQGEVPEPQDMKVAEVLFDAADANAIEEVNLAYENVKEVDGLDVSKEGT
EAWEAAMKRYDERIDRVETRITARLRDQLGTAKNANEMFRIFSRFNALFVRPHIRGAIRE
YQTQLIQRVKDDIESLHDKFKVQYPQSQACKMSHVRDLPPVSGSIIWAKQIDRQLTAYMK
RVEDVLGKGWENHVEGQKLKQDGDSFRMKLNTQEIFDDWARKVQQRNLGVSGRIFTIEST
RVRGRSGNVLKLKVNFLPEIITLSKEVRNLKWLGFRVPLAIVNKAHQANQLYPFAISLIE
SVRTYERTCEKVEERNTISLLVAGLKKEVQALIAEGIALVWESYKLDPYVQRLAETVFNF
QEKVDDLLIIEEKIDLEVRSLETCMYDHKTFSEILNRVQKAVDDLNLHSYSNLPIWVNKL
DMEIERILGVRLQAGLRAWTQVLLGQAEDKSEVDMDTDAPQVSHKPGGEPKIKNVVHELR
ITNQVIYLNPPIEECRYKLYQEMFAWKMIVLSLPRIQSQRYQVGVHYELTEEEKFYRNAL
TRMPDGPVALEESYSAVMGIVTEVEQYVKVWLQYQCLWDMQAENIYNRLGEDLSKWQALL
VQIRKARGTFDNAETKKEFGPVVIDYGKVQSKVNLKYDSWHKEVLSKFGQMLGSNMTEFH
SQISKSRQELEQHSVDTASTSDAVTFITYVQSLKRKIKQFEKQVELYRNGQRLLEKQRFQ
FPPSWLYIDNIEGEWGAFNDIMRRKDSAIQQQVANLQMKIVQEDRAVESRTTDLLTDWEK
TKPVTGNLRPEEALQALTIYEGKFGRLKDDREKCAKAKEALELTDTGLLSGSEERVQVAL
EELQDLKGVWSELSKVWEQIDQMKEQPWVSVQPRKLRQNLDGLLNQLKNFPARLRQYASY
EFVQRLLKGYLKINMLVIELKSEALKDRHWKQLMKRLHVNWVVSELTLGQIWDVDLQKNE
AIVKDVLLVAQGEMALEEFLKQIREVWNTYELDLVNYQNKCRLIRGWDDLFNKVKEHINS
VSAMKLSPYYKVFEEDALSWEDKLNRIMALFDVWIDVQRRWVYLEGIFTGSADIKHLLPV
ETQRFQSISTEFLALMKKVSKSPLVMDVLNIQGVQRSLERLADLLGKIQKALGEYLERER
SSFPRFYFVGDEDLLEIIGNSKNVAKLQKHFKKMFAGVSSIILNEDNTVVLGISSREGEE
VIFKTPVSITEHPKINEWLTLVEKEMRVTLAKLLAESVTEVEIFGKATSIDPNTYITWID
KYQAQLVVLSAQIAWSENVETALSSTSGSGDAATLQSVLSNVEVTLNVLADSVLMEQPPL
RRRKLEHLITELVHQRDVTRSLIKSKIDNSKSFEWLSQMRFYFDPKQTDVLQQLSIQMAN
AKFNYGFEYLGVQDKLVQTPLTDRCYLTMTQALEARLGGSPFGPAGTGKTESVKALGHQL
GRFVLVFNCDETFDFQAMGRIFVGLCQVGAWGCFDEFNRLEERMLSAVSQQVQCIQEALR
EHSNPNFDKTSAPITCELLNKQVKVSPDMAIFITMNPGYAGRSNLPDNLKKLFRSLAMTK
PDRQLIAQVMLYSQGFRTAEVLANKIVPFFKLCDEQLSSQSHYDFGLRALKSVLVSAGNV
KRERIQKIKREKEERGEVVDEGEVAENLPEQEILIQSVCETMVPKLVAEDIPLLFSLLSD
VFPGVQYHRGEMTALREELKKVCQEMYLTYGDGEEVGGMWVEKVLQLYQITQINHGLMMV
GPSGSGKSMAWRVLLKALERLEGVEGVAHIIDPKAISKDHLYGTLDPNTREWTDGLFTHV
LRKIIDNVRGELQKRQWIVFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSLPPNVRIMF
EVQDLKYATLATVSRCGMVWFSEDVLSTDMIFNNFLARLRSIPLDEGEDEAQRRRKGKED
EGEEAASPMLQIQRDAATIMQPYFTSNGLVTKALEHAFKLEHIMDLTRLRCLGSLFSMLH
QACRNVAQYNANHPDFPMQIEQLERYIQRYLVYAILWSLSGDSRLKMRAELGEYIRRITT
VPLPAAPSVPIIDYEVSISGEWSPWQAKVPQIEVETHKVAAPDVVVPTLDTVRHEALLYT
WLAEHKPLVLCGPPGSGKTMTLFSALRALPDMEVVGLNFSSATTPELLLKTFDHYCEYRR
TPNGVVLAPVQLGKWLVLFCDEINLPDMDKYGTQRVISFIRQMVEHGGFYRTSDQTWVKL
ERIQFVGACNPPTDPGRKPLSHRFLRHVPVVYVDYPGPASLTQIYGTFNRAMLRLIPSLR
TYAEPLTAAMVEFYTMSQERFTQDTQPHYIYSPREMTRWVRGIFEALRPLETLPVEGLIR
IWAHEALRLFQDRLVEDEERRWTDENIDMVALKHFPNIDKERAMSRPILYSNWLSKDYIP
VDQEELRDYVKARLKVFYEEELDVPLVLFNEVLDHVLRIDRIFRQPQGHLLLIGVSGAGK
TTLSRFVAWMNGLSVYQIKVHRKYTGEDFDEDLRTVLRRSGCKNEKIAFIMDESNVLDSG
FLERMNTLLANGEVPGLFEGDEYATLMTQCKEGAQKEGLMLDSHEELYKWFTSQVIRNLH
VVFTMNPSSEGLKDRAATSPALFNRCVLNWFGDWSTEALYQVGKEFTSKMDLEKPNYIVP
DYMPVVYDKLPQPPSHREAIVNSCVFVHQTLHQANARLAKRGGRTMAITPRHYLDFINHY
ANLFHEKRSELEEQQMHLNVGLRKIKETVDQVEELRRDLRIKSQELEVKNAAANDKLKKM
VKDQQEAEKKKVMSQEIQEQLHKQQEVIADKQMSVKEDLDKVEPAVIEAQNAVKSIKKQH
LVEVRSMANPPAAVKLALESICLLLGESTTDWKQIRSIIMRENFIPTIVNFSAEEISDAI
REKMKKNYMSNPSYNYEIVNRASLACGPMVKWAIAQLNYADMLKRVEPLRNELQKLEDDA
KDNQQKANEVEQMIRDLEASIARYKEEYAVLISEAQAIKADLAAVEAKVNRSTALLKSLS
AERERWEKTSETFKNQMSTIAGDCLLSAAFIAYAGYFDQQMRQNLFTTWSHHLQQANIQF
RTDIARTEYLSNADERLRWQASSLPADDLCTENAIMLKRFNRYPLIIDPSGQATEFIMNE
YKDRKITRTSFLDDAFRKNLESALRFGNPLLVQDVESYDPVLNPVLNREVRRTGGRVLIT
LGDQDIDLSPSFVIFLSTRDPTVEFPPDLCSRVTFVNFTVTRSSLQSQCLNEVLKAERPD
VDEKRSDLLKLQGEFQLRLRQLEKSLLQALNEVKGRILDDDTIITTLENLKREAAEVTRK
VEETDIVMQEVETVSQQYLPLSTACSSIYFTMESLKQIHFLYQYSLQFFLDIYHNVLYEN
PNLKGITDHTQRLCIITKDLFQVAFNRVARGMLHQDHITFAMLLARIKLKGTIGEPTYDA
EFQHFLRGKEIVLTAGSTPTIQGLTVEQAEAVVRLSCLPAFRDLIAKVQADQQFGIWLDS
SSPEQTVPYLWSEESPATPIGQAIHRLLLIQAFRPDRLLAMAHVFVSTNLGESFMSIMEQ
PLDLTHIVDTEVKPNTPVLMCSVPGYDASGHVEDLAAEQNTQITSIAIGSAEGFNQADKA
INTAVKSGRWVMLKNVHLAPGWLMQLEKKLHSLQPHACFRLFLTMEINPKVPVNLLRAGR
IFVFEPPPGVKANMLRTFSSIPVSRICKSPNERARLYFLLAWFHAIIQERLRYAPLGWSK
KYEFGESDLRSACDTVDTWLDDTAKGRQNISPDKIPWSALKTLMAQSIYGGRVDNEFDQR
LLNTFLERLFTTKSFDSEFKLACKVDGHKDIQMPDGIRREEFVQWVELLPDTQTPSWLGL
PNNAERVLLTTQGVDMISKMLKMQMLEDEEDLAYAETEKKARADSTPDGRPAWMRTLHTT
ASNWLHLIPQTLSHLKRTVDNIKDPLFRFFEREVKMGAKLLQDVRQDLADVVQVCEGKKK
QTNYLRTLINELVKGILPRSWSHYTVPAGMTVIQWVADFSERVKQLQNISLAAASGGAKE
LKNIHVCLGGLFVPEAYITATRQYVAQANSWSLEELCLEVNVTTSQNATLDACSFGVTGL
KLQGATCSNNKLSLSNAISTVLPLTQLRWVKQTNAEKKANVVTLPVYLNFTRADLIFTVD
FEIATKEDPRSFYERGVAVLCTE
NT seq 13752 nt   +upstreamnt  +downstreamnt
atgactttcccaggatcacgcagctctgtcgccgcctttgctggtacatcccaaggtgaa
agtgaagaggatgtcggtgatgaaggagaagaagagaaggaattcatttcctacaacatc
aacatagacattcattacggagtcaagtccaacagcttggccttcattaaacgcactcca
gtgattgacgcagacaagcccgtgtcgtcccagctccgtgtcctgacgctcagcgaggac
tccccatacgaaactctgcactctttcatcagcaatgcggtggctcctttcttcaagtcc
tacatcagagagtcgggcaaggcagacagggatggtgataaaatggctccttcagttgag
aaaaagattgcggaacttgagatgggactcctacacctgcagcagaacattgagatcccc
gagatcagcttacccatccacccgatcatcacgaacgttgccaagcagtgctacgagcgt
ggagaaaagccaaaagttacagactttggagacaaggtggaagaccccacttttctcaac
cagctacaatctggagttaaccgctggatccgcgaaatccagaaagtgaccaagcttgat
cgagacccggcctcaggaactgccttacaggaaatcagtttttggctgaacttggagcgt
gcgctgtaccgcatacaggagaagcgcgagagcccggaggtcctgctgacgctggacatt
ctgaagcacggcaagcgcttccacgccaccgtcagcttcgacaccgacacaggtctaaaa
caggcattggaaaccgtgaacgactacaaccctctgatgaaagatttcccgctgaacgat
ttgctgtctgccactgagctggacaaaatacggcaggcgctggtggcgattttcacccac
ctgaggaagatccggaacaccaagtaccccattcagagggcgctgcgcctggtggaggcc
atttccagggacctgagctctcagctgctgaaagtgctgggcaccaggaaactaatgcac
gtggcttatgaagagtttgagaaagtcatggtcgcgtgcttcgaggtgttccagacctgg
gacgacgaatatgagaaactccaggtgctgctgagggacatcgtgaagaggaagcgggag
gagaacctgaagatggtgtggcggatcaaccccgcccacaggaagctgcaggcccgcctc
gaccagatgcgcaagttccggcgccagcacgagcagctgagggccgtcatcgtcagggtt
ctgcggccccaggtcactgcggtcgcacagcagaatcaaggggaggtccctgaaccccag
gatatgaaagtagccgaggttctctttgatgctgccgacgcaaatgccattgaggaggtg
aacctcgcttatgagaatgtcaaggaggtggacggactcgatgtctccaaggaaggcacg
gaggcctgggaggccgccatgaagagatacgacgagaggatcgacagggtggagacccgg
atcaccgctcgcctgcgagatcagctgggcacggccaagaatgccaacgagatgttcagg
atcttctccaggttcaacgcactgtttgtgagaccgcacatccgcggggccatccgcgag
taccagacccagcttatccagcgggtgaaggacgacatcgagtccctgcacgacaagttc
aaagtgcagtacccgcagagccaggcctgcaagatgagccacgtgcgcgacctgccgccg
gtgtcggggtccatcatctgggcgaagcagatcgacaggcagctgaccgcctacatgaag
cgcgtggaggacgtcctgggcaagggctgggagaaccacgtggaggggcagaagctgaaa
caggacggcgacagcttccgcatgaagctcaacactcaggaaatatttgacgactgggcc
cggaaggtgcagcagcggaacctgggcgtctcggggcgcatcttcaccatcgaaagcacc
cgggttcggggccgatccgggaatgtcctcaagctcaaggtcaacttccttcccgagatc
atcacgctttcaaaagaagttcgcaacctcaagtggctcggtttccgcgtccctctggca
attgtgaacaaagcccaccaagccaaccagctctacccgttcgccatctccctgatcgag
agcgtgcgcacctacgagcgcacctgtgagaaggtggaggagcggaacaccatctccctg
ctggtggccggcctgaagaaggaagtgcaggccctgatcgcagagggcatcgcgctggtg
tgggagtcctacaagctcgacccctacgtgcagcgactggcagagactgtcttcaacttc
caggagaaggtggatgacctattgatcattgaagaaaaaatagacctggaagtgcgttca
ttggagacctgtatgtacgatcacaagactttctccgagatcctgaacagagtccagaaa
gccgtggatgacctgaacctgcactcctactccaacctgcccatctgggtcaacaagctg
gacatggagattgaaagaatactcggtgtccgcctgcaagctggcctgagagcttggacc
caggtgcttctcggacaagctgaagataaatctgaagttgacatggacacggacgcgcca
caagtcagtcacaagcctggtggagagccaaagatcaagaacgttgtccacgagctcaga
atcaccaatcaggttatctacttgaacccacccatcgaagagtgcaggtacaagctgtac
caggaaatgtttgcctggaagatgattgtgctgtctctccccaggatccagagtcagagg
taccaggtgggtgtgcattatgaattgaccgaagaggagaagttctaccggaatgccctg
acgcggatgccagacggccccgtggccctggaagagtcctactctgcagtcatgggcatt
gtaactgaggtcgaacagtacgtcaaggtctggctacagtaccagtgcctgtgggacatg
caggctgagaacatctacaacagactcggggaggacctcagcaagtggcaggctctcctg
gtgcagatacggaaggccagggggacctttgacaacgcagagaccaagaaggagttcgga
cccgtggtcattgactacggcaaggtgcagtccaaggtgaacctgaagtacgactcctgg
cacaaggaggtcctcagcaagtttgggcagatgcttggatccaacatgacagaattccat
tcgcagatctccaagtctcgccaggagctggagcaacactccgtggacacggccagcacc
tcagatgcggtgacgttcatcacctacgtgcagtctctgaagcggaagatcaagcagttt
gagaagcaagttgagctctaccgcaatggtcagcgcttgctggagaagcagaggttccag
ttcccgccctcctggctgtacattgacaacatcgagggcgagtggggggccttcaatgac
atcatgcggcggaaggactctgccattcagcagcaggtagcaaacctgcagatgaagatc
gtgcaggaggaccgggctgtggagagccgcaccactgacctgctgaccgactgggaaaag
accaagcccgtcacgggcaatctccgcccagaggaggctctccaggctctcaccatatac
gagggcaagttcggcaggctgaaggatgaccgtgaaaaatgtgcgaaggccaaggaggca
ctggagttgacagacacggggctgctgagcggcagcgaggagcgtgtccaggtggcccta
gaggaactacaggacctcaagggcgtgtggtcggaactctctaaagtctgggaacagatc
gatcagatgaaggagcagccatgggtctcagtgcagcctcggaagcttcgacagaacttg
gatggcctcctgaaccagctgaaaaacttccctgcgcgcttgcggcaatatgcttcctat
gagtttgtgcagcggcttctgaaaggctacctgaagatcaacatgctggtgatcgagctg
aagtccgaggccctgaaggatcgccactggaagcaactgatgaagaggctgcacgtgaac
tgggtggtgtccgagctcacccttgggcagatctgggacgtcgacctacagaaaaacgag
gccattgtcaaggacgtgctgcttgtggcacaaggcgagatggcgttggaagagtttttg
aagcagataagagaagtgtggaatacgtacgaattagacttggttaactatcagaacaag
tgtcgcttgattcgtggctgggacgacctcttcaacaaggtcaaagagcacatcaacagc
gtctccgccatgaagctgtctccgtactacaaggtctttgaggaggatgccctgagctgg
gaagataagctgaaccgcatcatggccctctttgacgtgtggatcgacgtgcagaggcgc
tgggtctacctggaaggcatcttcacaggcagcgcggatatcaagcacctgctgcccgtg
gaaacccagcggttccagagcatcagcaccgagtttctggcgctcatgaaaaaagtatcc
aagtctcccctcgtgatggatgttctcaacatccagggggtgcagagatctctggagaga
ctggcagacctgctggggaagatccagaaagccctgggagagtacctggaaagggagcgg
tcatctttccccaggttctattttgtgggtgatgaagatttgcttgaaatcattggaaac
agcaagaatgtagctaagttacagaagcacttcaagaaaatgttcgccggagtttccagc
atcatcctgaacgaggacaacactgttgtcttgggcatctcgtcccgcgaaggagaggag
gttatatttaaaactcccgtgtcaatcactgaacatcccaaaatcaacgagtggctcacg
ctggtggagaaggagatgagggtcacgctggccaaactcctggccgagtctgtgacagag
gtggagatttttggtaaagccacttcaatcgaccccaacacctacatcacttggatcgat
aaataccaggcccagcttgtggttttgtcggcccagatagcctggtctgaaaacgtggag
acggcactgagcagcacgagtggaagcggggacgcagcaaccctgcagtcggtgctgagc
aacgtggaggtcaccctcaacgtgctggccgactcggtcctcatggagcagcccccgctc
cgccggcggaagctagagcacctgattacagagctggttcatcagagagacgtcacccgg
tccctgatcaagagcaagatcgacaacagcaagtccttcgaatggctcagccagatgcgg
ttttacttcgacccaaagcagacggatgtgttgcagcagctgtcgatccagatggcaaat
gccaagtttaactatggctttgagtacctgggagtccaggacaagctggtccagactccc
ctcaccgaccgctgctacttgacaatgacccaagccctagaggcccggctgggcgggtcc
cctttcgggcccgcagggaccgggaagaccgagtctgtcaaagctctgggccatcagctg
ggacgtttcgttttggttttcaactgtgatgaaacctttgatttccaggcgatgggacgc
atcttcgtggggctctgccaagtgggcgcctggggctgttttgacgagttcaaccggctg
gaggagcggatgctgtcggctgtgtcccagcaggtgcagtgcatccaggaagcactgcgg
gagcactccaaccccaacttcgacaagacctctgcccccatcacttgtgagctgctgaac
aagcaggttaaggtgagcccggacatggccatcttcatcaccatgaaccccggctacgcg
ggccgctccaacctgcccgacaacctgaagaagctgttccggagcctggccatgaccaaa
cccgaccgccagctgatcgcccaggtgatgctgtactcgcagggcttccgcacggccgag
gtcctcgccaacaagatcgtgcccttctttaagctgtgtgacgagcagctctcctcccag
agccactatgactttgggctccgagctctgaagagcgtgctggtgagtgcgggaaacgtg
aagagggagcggattcagaagataaagagagagaaggaagagcggggcgaagtcgtggac
gagggagaggttgcagaaaacctgcccgagcaggagattctgatccagagcgtctgcgag
acgatggtgcccaagctggtggcagaggacatcccgctgctcttcagtctcctgtcggac
gtgttccccggagtccagtaccaccgcggggagatgaccgcactccgggaggaactgaag
aaagtgtgtcaggagatgtatctgacctacggagacggggaggaagttggcggaatgtgg
gttgaaaaggtcctccagctctaccagatcacccagatcaaccatggtctgatgatggtg
gggccctcaggcagcgggaagagcatggcctggcgcgttcttctcaaggctctggagagg
ctcgagggggtggaaggtgtggcccatatcatcgaccccaaggccatcagcaaagaccac
ctgtacggaaccctggaccccaacaccagggaatggaccgatgggctgttcacacacgtc
ctgaggaagatcatcgacaacgtgcgaggtgagctgcagaagcgccagtggatcgtcttc
gacggtgacgtggaccccgagtgggtggagaacctgaactcggtgctggacgacaacaag
ctcctgactctgcccaacggggagcgtctcagcctcccccccaatgtgcgaatcatgttt
gaggtgcaggacttgaagtacgccacgctggccacggtgtcgcgctgcggcatggtctgg
ttcagcgaggatgtgctcagcaccgacatgatcttcaacaacttcctggcccggctgcgc
agcatccccctagacgaaggcgaggacgaggcccagcgccggcgcaagggcaaagaggac
gagggggaggaggccgcgtccccgatgctgcagatccaaagggacgcggccaccatcatg
cagccgtacttcacgtccaacggcctggtcaccaaggccctggagcacgccttcaagctg
gagcacatcatggacctgacgcggctccgctgcctgggctcgctcttctccatgctgcac
caggcctgccgcaacgtggcgcagtacaacgccaaccaccccgacttccccatgcagatc
gagcagctggagcgctacatccagcggtacctggtctacgccattctctggtcgctgtct
ggggacagccggctgaagatgagagcggagctgggcgagtacatcaggaggatcacaacc
gtgcccctgcccgccgcgcccagtgtccccatcatcgattacgaggtgtccatcagtggg
gagtggtcgccgtggcaggccaaggtgccgcagattgaagtggagacccacaaggtggcg
gcccctgacgtcgtggtgccgaccctggacacggtccgccacgaggccctgctgtacacc
tggctggccgagcacaagccgctggtcctgtgtggcccccccgggtccggcaagaccatg
acactcttcagcgccctccgggccctgcccgacatggaggttgtgggtctgaacttctct
agtgccacgacaccggagctgctgctgaagacatttgaccactactgcgagtacaggcgc
acacccaacggagtggtcctcgctcccgtgcagcttggcaagtggctggtgctgttctgt
gatgagatcaacctgcctgacatggacaaatacgggacacagagggtcatctccttcatc
agacagatggtggaacatggaggcttttaccgaacctcagatcaaacctgggtgaagctg
gaaagaatccagtttgtcggggcttgtaatccgcccacagatcctgggagaaagccgctc
tctcacaggttcttgcggcacgtgccagtggtgtatgtggactacccggggcctgcctcc
ctgacacagatctacggcaccttcaaccgagccatgctgcggctcatcccctcgctgcgc
acgtacgcggagccactcaccgccgccatggtggagttctacaccatgtcccaggagaga
ttcacacaggacacgcaaccccactacatctattcaccccgtgaaatgacgaggtgggtg
cgcggcatctttgaggccctgaggcccctagagaccctgcctgtggagggactcatcagg
atttgggcccacgaagccctccgcctcttccaagacaggctcgtcgaggacgaggagcgg
cgctggaccgacgagaacattgacatggtggctctgaagcacttccccaacatagacaag
gagagggccatgagccggcccatcctctacagcaactggctctcgaaggactacatccca
gtagaccaagaagagttgagagattatgtcaaagcgaggctcaaggtcttctatgaggaa
gagcttgacgttcccctggtcctgttcaatgaagtgctggaccacgtgctcaggatcgac
cgaatattccgccagccccaaggccacctgcttctgattggtgtcagtggggcgggaaaa
accaccctgtcccggttcgtggcctggatgaacggtttgagtgtgtaccagatcaaggtc
cacagaaagtacacaggggaagacttcgatgaagaccttcggacagtgttgagacgttct
ggctgtaaaaatgaaaagatagcatttataatggatgagtccaatgtgttagactctgga
ttcctggagcgaatgaacacacttctggccaacggagaggtccctggtctgttcgaagga
gacgagtatgccaccttgatgacccagtgcaaggagggcgcccagaaggagggcctgatg
ctggactcgcacgaggagctgtacaagtggttcaccagccaggtcatccgcaacctgcat
gtcgtcttcaccatgaacccgtcctcagaggggctcaaggaccgtgcggccacgtccccc
gcacttttcaacaggtgtgtgttgaactggtttggggactggtccacggaagcgctctat
caggttggcaaagaattcaccagtaagatggacctggagaagccaaactacatcgtgcct
gactacatgccggtcgtgtacgacaagctcccgcagccgccctcgcaccgggaggccatt
gtgaacagctgcgtgttcgtccatcagactcttcaccaggctaacgctcggctcgctaag
cggggcggcaggaccatggccatcacgccgcgccactacctggacttcatcaaccactat
gccaacctgttccacgagaagcggagtgagctggaggagcagcagatgcacctgaatgtc
gggctccggaagatcaaggagaccgtcgaccaggtagaagagctgcgtcgtgacctgagg
ataaagagccaggagctggaggtaaagaacgcagcagctaacgacaagctgaagaagatg
gtgaaggaccagcaggaggccgagaagaaaaaggtcatgagccaggaaatccaggagcag
ctgcacaagcagcaggaagtcatcgcagacaagcagatgagtgtgaaagaagacctggac
aaggtggagcctgccgtcatcgaggcccagaatgccgtgaagtccataaagaagcagcac
ctggtggaggtgcggtccatggccaaccccccggccgccgtgaagctggcgctcgagtcc
atctgcctgctgctgggggagagcaccacggactggaagcaaatccgctccatcatcatg
cgagagaacttcatccccaccatcgtgaacttctccgccgaggagatcagtgacgccata
cgggagaagatgaagaagaactacatgtccaaccccagctacaactacgagatcgtgaac
cgggcctccctggcctgcggcccgatggtgaagtgggcgatcgcacagcttaactacgcg
gacatgctgaagcgcgtggagcccctgcgcaatgagctgcagaagctggaggatgacgcc
aaggacaaccagcagaaagccaacgaggtggagcagatgatccgggacctggaagccagc
attgcccgctacaaggaggaatacgcagtgctcatctccgaggcccaggccatcaaggcc
gacctggcggccgtcgaggcgaaagtaaacaggagcaccgccctcctgaagagcttgtct
gctgaacgcgagcgatgggaaaaaacaagtgaaaccttcaaaaaccagatgtcgaccatt
gctggggactgtctcctgtcagcggcgttcatcgcatacgcaggctactttgaccagcag
atgcggcagaacctgttcaccacgtggtctcatcacttgcagcaggccaacatccagttc
cgcacagatatcgccaggacggaatacctttccaacgcggacgagcggctgcgctggcag
gccagctccctacctgccgatgatctgtgtacagaaaacgccatcatgctcaaacgcttc
aacaggtacccgctgatcatcgacccctcgggacaggccacggagttcatcatgaacgag
tacaaggaccgcaagatcacacggaccagcttcctggacgacgccttcaggaagaacctg
gagagtgctctgcggttcgggaaccccctcctggtccaggacgtggagagctacgaccca
gtgctgaatccagtgctgaaccgcgaggtgcggcgcacgggagggagagtgctgattacc
ctcggggaccaggacattgacctgtccccctcgttcgtcatcttcctgtccacccgcgat
ccaaccgtggagttccccccagacctctgctcccgggtcaccttcgtcaacttcaccgtc
acccgcagcagtttacagagccaatgtctcaacgaggtacttaaagcagagcgacctgac
gtggacgagaagcgctccgaccttcttaagcttcagggggagttccagctgcgcctgcgt
cagctggagaagtctctgctgcaagcgctgaacgaagtgaaagggcgcatcctagacgac
gacacgatcatcacgacactggagaacctcaagcgggaggcagcggaggtgacgcgaaag
gtggaggagaccgacatcgtgatgcaggaggtggagaccgtgtcccagcagtacctgccg
ctgtccaccgcctgcagcagcatctacttcaccatggagtccctgaagcagatacacttc
ctgtaccagtactccctgcagttcttcctggacatttaccacaatgtcctgtacgagaac
ccgaacctgaagggcatcaccgaccacacacagcgcctctgcatcatcaccaaggacctc
ttccaggtggcattcaaccgggtggccaggggcatgctgcaccaggaccacatcaccttt
gccatgctgctggccaggatcaagctgaagggcaccatcggggagcccacctacgatgcc
gagttccagcacttcctgagagggaaagagattgtgctgacggctggctcgacgcccacg
atccagggtctgaccgtggaacaggctgaagccgtcgtgaggctgagctgtctccctgct
ttcagagacctgatcgcaaaggtccaggccgaccagcaatttggcatctggctggacagc
agctccccagagcagacggtgccctacctctggagtgaagagagccccgcaacacccatt
gggcaagccatccaccgcctgctcctgattcaggctttccgccccgaccgcctgctggcc
atggcccacgtgtttgtctccacgaacctcggggagtccttcatgtccatcatggagcag
ccgctcgacctgacgcacatcgtggacacagaggtgaagccaaacacacccgtcctcatg
tgctctgtgcctggttatgatgccagcgggcacgtggaagacctggcggccgagcagaac
acgcagatcacatcgatcgccatcggctctgctgaaggcttcaaccaggcagacaaggcg
ataaacacagcagtgaagtcgggcaggtgggtgatgctgaagaacgtgcacctggcccca
gggtggctgatgcagctggagaagaagctgcactccctgcagccgcacgcctgcttccgg
ctcttcctcaccatggagatcaaccccaaggtgcccgtgaacctgctccgagccggccgc
atcttcgtgtttgagccgcccccaggtgtgaaggccaacatgctgaggacgttcagcagc
atccccgtgtctcggatatgcaagtcccccaatgagcgggctcgcctgtacttcctgctg
gcctggttccacgccatcatccaagaacgcctacgatacgcacccctggggtggtccaag
aaatatgagtttggggagtctgacctgaggtcggcctgtgacaccgtggacacgtggctg
gatgacacagcaaagggccggcagaacatctctccagataagatcccgtggtctgcgctg
aagaccctgatggcccagtccatctacggtgggcgagtggacaacgagtttgaccagcgc
ctactgaacaccttcctggagcgtctcttcacgaccaagagtttcgacagcgagttcaag
ctggcctgcaaggtggacgggcacaaagacattcagatgcccgacggcatcaggcgggag
gagttcgtgcagtgggtggagctgctccccgacacccagacgccctcctggctgggcctg
cccaacaacgccgagagggtcctcctcaccacccagggcgtggacatgatcagtaagatg
ctgaagatgcagatgctggaggacgaagaggacctggcctacgcggagacggagaagaag
gcgcgggcggactccacgcccgacgggcgccccgcctggatgaggaccctgcacaccacc
gcctccaactggctgcaccttataccccagacgctcagccacctcaagcggacggtggac
aacatcaaggaccctttgttccgattcttcgagagagaagtgaagatgggagcaaaattg
ctgcaggacgtccgccaggacctcgccgatgtcgtccaagtgtgtgaagggaagaaaaag
cagaccaactacctgcgcacgctcattaacgagctcgtgaaagggatcctgccacggagc
tggtcccactacacggtacctgcgggcatgaccgtcatccagtgggtggccgacttcagc
gagagggtcaagcagctgcagaacatctcactggcagcggcatctggcggcgccaaggag
ctgaagaacatccacgtgtgtctgggtggcctgttcgtgcccgaggcgtacatcacggcc
acgcggcagtacgtggcccaggccaacagctggtcgctggaggagctgtgcctggaggtc
aacgtcaccacttcgcagaacgccacgctcgacgcctgcagctttggggtcacgggcctg
aagctgcagggggccacgtgcagcaacaacaagctctcgctctccaacgccatctccacc
gtgctgcctctcacgcagctgcgctgggtcaagcagacaaacgcagagaaaaaggccaac
gtggtgaccttacccgtgtacctgaacttcacccgggcagacctcatcttcacagtggac
tttgagatcgccaccaaggaagatccccgcagcttctacgagcgcggcgtcgctgtgctg
tgcacggagtga

KEGG   Miniopterus natalensis: 107537214
Entry
107537214         CDS       T05883                                 

Gene name
DYNC1LI2
Definition
(RefSeq) cytoplasmic dynein 1 light intermediate chain 2 isoform X1
  KO
K10416  dynein light intermediate chain 1, cytosolic
Organism
mna  Miniopterus natalensis
Pathway
mna04145  Phagosome
mna04962  Vasopressin-regulated water reabsorption
mna05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107537214 (DYNC1LI2)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107537214 (DYNC1LI2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107537214 (DYNC1LI2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107537214 (DYNC1LI2)
   03036 Chromosome and associated proteins [BR:mna03036]
    107537214 (DYNC1LI2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mna04812]
    107537214 (DYNC1LI2)
Membrane trafficking [BR:mna04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab4 associated proteins
    107537214 (DYNC1LI2)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     Dynein complex
      107537214 (DYNC1LI2)
Cytoskeleton proteins [BR:mna04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     107537214 (DYNC1LI2)
SSDB
Motif
Pfam: DLIC ABC_tran AAA_22 AAA_16 Arf PduV-EutP AAA_7 Roc AAA_24 AAA_25 AAA_29 NACHT G-alpha ATPase SRP54
Other DBs
NCBI-GeneID: 107537214
NCBI-ProteinID: XP_016068681
LinkDB
Position
Unknown
AA seq 492 aa
MAPVGVEKKVLLGPNGPAVAAAGDLTSEEEEGQSLWSSILSEVSTRARSKLPAGKNILVF
GEDGSGKTTLMTKLQGAEHGKKGRGLEYLYLSVHDEDRDDHTRCNVWILDGDLYHKGLLK
FAVSAESLPETLVIFVADMSRPWAVMESLQKWASVLREHIDKMKIPPEEMRELERKFVKD
FQDYIEPEEGCQGSPQRRGPLTSGPDEENVALPLGDNVLTHNLGIPVLVVCTKCDAVSVL
EKEHDYRDEHFDFIQSHLRRFCLQYGAALIYTSVKEEKNLDLLYKYIVHKTYGFHFTTPA
LVVEKDAVFIPAGWDNEKKIAILHENFTTVKPEDAYEDFIVKPPVRKLVHDKELAAEDEQ
VFLMKQQSLLAKQPATPTRASESPARGPSGSPRTQGRGGPASVPSASPGTSVKKPDPNIK
NNAASEGVLASFFNSLLSKKTGSPGSPGATGVQSTAKKSGQKTVLTNVQEELDRITRKPD
SMVTNSSTENEA
NT seq 1479 nt   +upstreamnt  +downstreamnt
atggcgccggtgggggtggagaagaaggtgcttctgggtcccaacgggcccgcggtggca
gccgccggcgacctgaccagtgaggaagaggagggccagagcttatggtcctccatcctg
agcgaggtgtccacccgcgccaggtccaagctgccagccggcaagaacatcctggtgttc
ggtgaagatggttctggtaaaacaacactcatgactaaactacaaggcgctgaacatggc
aaaaaaggaagaggcctggaatatctctacctcagcgtgcatgacgaggaccgagatgat
cacacacgctgtaacgtatggattctggatggagacctataccacaaaggcctgctgaaa
tttgcagtttctgctgaatccttgccggagaccctggtcattttcgttgcagacatgtct
aggccttgggctgtgatggaatctctacagaaatgggctagtgttttacgtgaacacatt
gataaaatgaaaattccaccagaagaaatgagggagctggaacggaagtttgtgaaagat
tttcaagactatattgaacctgaagaaggttgtcaaggttccccacagagaagagggcct
ctgacctcaggtcctgatgaagaaaatgttgccctgcctcttggtgacaacgtgctgact
cataatctggggataccagtgttggtggtgtgcacaaagtgtgatgccgtgagcgtactg
gagaaagagcatgattacagggacgagcactttgactttatccagtcacatctacggagg
ttctgcctgcagtatggagctgccttgatttacacatcagtgaaggaagagaaaaacctc
gacttgttgtataagtacattgttcataaaacatatggtttccactttaccacacctgcc
ttagttgtggaaaaggatgcagtttttatacctgctggctgggacaatgaaaagaaaata
gctatattacatgaaaatttcacaactgtgaagccagaagatgcatatgaagactttatt
gtgaaacctcctgtgagaaagctggtccacgacaaagagttggcagcggaggatgagcag
gtgttcctaatgaagcaacagtcactccttgccaagcagccagccacgcccacgagagcc
tccgagtcgcctgcgagaggaccctctggctctccaagaactcagggccggggagggcca
gccagcgtgcccagtgcctccccaggcacatcagtaaagaagccggatccaaacatcaaa
aataacgcagcaagtgaaggggtgttggccagcttcttcaacagtctgttgagtaaaaaa
acaggctctcctggaagtcctggtgctactggggtgcagagcacagccaagaagtcagga
caaaagactgtgttgacaaatgttcaggaagaactggatagaattactcgaaaaccagac
tccatggtaacaaactcttcaacagaaaatgaagcctga

KEGG   Miniopterus natalensis: 107541728
Entry
107541728         CDS       T05883                                 

Gene name
DYNC1I1
Definition
(RefSeq) cytoplasmic dynein 1 intermediate chain 1 isoform X1
  KO
K10415  dynein intermediate chain, cytosolic
Organism
mna  Miniopterus natalensis
Pathway
mna04145  Phagosome
mna04962  Vasopressin-regulated water reabsorption
mna05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107541728 (DYNC1I1)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107541728 (DYNC1I1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107541728 (DYNC1I1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107541728 (DYNC1I1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mna04812]
    107541728 (DYNC1I1)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     Dynein complex
      107541728 (DYNC1I1)
Cytoskeleton proteins [BR:mna04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     107541728 (DYNC1I1)
SSDB
Motif
Pfam: Dynein_IC2 WD40 ANAPC4_WD40 His_Phos_1
Other DBs
NCBI-GeneID: 107541728
NCBI-ProteinID: XP_016074367
LinkDB
Position
Unknown
AA seq 628 aa
MSDKSDLKAELERKKQRLAQIREEKKRKEEERKKKEADMQQKKEPVQDDSDLDRKRRETE
ALLQSIGISPEPPLVPTPMSPSSKSVSTPSEAGSQDSGDLGPLTRTLQWDTDPSVLQLQS
DSELGRRLHKLGVSKVTQVDFLPREVVSYSKETQTPLATHQSEEDEEDEEMVEPKIGHDS
ELESQDKKQEVKEAPPRELTEEEKQQILHSEEFLIFFDRTIRVIERALAEDSDIFFDYSG
RELEEKDGDVQAGANLSFNRQFYDEHWSKHRVVTCMDWSLQYPELMVASYNNNEDAPHEP
DGVALVWNMKFKKTTPEYVFHCQSSVMSVCFARFHPNLVVGGTYSGQIVLWDNRSHRRTP
VQRTPLSAAAHTHPVYCVNVVGTQNAHNLITVSTDGKMCSWSLDMLSTPQESMELVYNKS
KPVAVTGMAFPTGDVNNFVVGSEEGTVYTACRHGSKAGIGEVFEGHQGPVTGINCHMAVG
PIDFSHLFVTSSFDWTVKLWTTKHNKPLYSFEDNADYVYDVMWSPVHPALFACVDGMGRL
DLWNLNNDTEVPTASVAIEGASALNRVRWAQAGKEVAVGDSEGRIWIYDVGELAVPHNDE
WTRFARTLVEIRANRADSEEEGAVELAA
NT seq 1887 nt   +upstreamnt  +downstreamnt
atgtctgacaaaagtgacttaaaagctgagctagagcgcaaaaaacagcgcttagcacag
ataagagaagagaagaaacggaaggaagaggagaggaaaaaaaaagaggccgacatgcag
cagaagaaagagccagttcaggacgactcagacctggatcgcaaacgccgggagacggag
gctttgcttcaaagcatcggtatatcgccggagccccctctagtcccaacccctatgtct
ccctcctcgaaatcagtgagcactcccagtgaagctggaagccaagactcgggcgacctg
ggaccattaacaaggaccctgcagtgggacacagacccctcagtgctccagctgcagtca
gactcagaacttggacgaagactacacaaactgggagtgtcgaaggttacccaagtggat
ttcctgcccagggaagtagtgtcctactccaaggagacccagactcctctggctacacat
cagtccgaagaggatgaagaagacgaggaaatggtggaacctaaaattggccacgattca
gaactggaaagtcaggacaaaaagcaggaagtgaaggaagcccccccaagggagctgaca
gaggaagagaaacagcagatcctccactcagaggagtttctcatctttttcgatcggacc
atccgcgtcatcgagagggccctggcagaagactcggacatcttcttcgactatagcggc
cgagagttagaggaaaaagatggggatgtccaggctggagccaacctttctttcaatcgt
cagttctatgatgagcattggtccaagcaccgagtagtcacttgtatggactggtctctc
cagtaccccgagctgatggtcgcttcctacaacaacaatgaagatgctccccatgaacca
gatggagtggccttggtttggaacatgaagttcaagaaaaccacaccagaatacgtcttc
cactgtcagtcctctgtgatgtccgtctgctttgctcgtttccatcccaatttggtggtt
ggtgggacttactccggccagatagtcctgtgggacaatcgcagtcatcggaggacgccc
gtgcagcggacgcccctgtcagctgctgcacacacacatcccgtgtactgtgtaaatgtt
gttgggacccagaatgctcacaacctcatcactgtctctactgatggcaaaatgtgttcc
tggagcctggacatgctctcaactccacaggagagcatggagctggtgtacaacaagtcc
aagcccgtggctgttaccggaatggctttcccgacgggcgacgtcaataacttcgtggtt
ggcagcgaggagggcacagtctacacggcctgtcgtcatggaagcaaagctgggatcggt
gaggtcttcgaaggtcaccaagggccagtcacaggaattaactgccacatggcagtgggc
cccatcgacttttcacacttgtttgtcacgtcatcatttgactggactgtcaaactgtgg
accacaaagcacaacaagccgctctactcctttgaagacaacgccgactatgtgtacgac
gtcatgtggtcccccgtgcaccccgcgctcttcgcctgcgtcgacgggatggggcgcttg
gacctctggaacctcaacaacgacaccgaggttccaacagcaagtgtggccattgagggg
gcgtccgccctaaaccgtgttcgttgggctcaagctggcaaagaagttgctgttggggac
tcagaaggccgtatttggatctacgatgttggagagctcgcagtaccccacaatgacgaa
tggacccggtttgccaggaccctcgtggagattcgcgctaacagagccgacagcgaggag
gagggcgccgtggagctggcggcctag

DBGET integrated database retrieval system