KEGG   Miniopterus natalensis: 107526398
Entry
107526398         CDS       T05883                                 

Gene name
MLH1
Definition
(RefSeq) DNA mismatch repair protein Mlh1 isoform X1
  KO
K08734  DNA mismatch repair protein MLH1
Organism
mna  Miniopterus natalensis
Pathway
mna01524  Platinum drug resistance
mna03430  Mismatch repair
mna03460  Fanconi anemia pathway
mna05200  Pathways in cancer
mna05210  Colorectal cancer
mna05213  Endometrial cancer
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    107526398 (MLH1)
   03460 Fanconi anemia pathway
    107526398 (MLH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107526398 (MLH1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107526398 (MLH1)
   05226 Gastric cancer
    107526398 (MLH1)
   05213 Endometrial cancer
    107526398 (MLH1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107526398 (MLH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mna03400]
    107526398 (MLH1)
DNA repair and recombination proteins [BR:mna03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     107526398 (MLH1)
SSDB
Motif
Pfam: Mlh1_C DNA_mis_repair HATPase_c_3 HATPase_c CAF1
Other DBs
NCBI-GeneID: 107526398
NCBI-ProteinID: XP_016054335
LinkDB
Position
Unknown
AA seq 754 aa
MSLAAGVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVVVKEGGLKLIQ
IQDNGTGIRKEDLDIVCERFTTSKLQSFEDLANISTYGFRGEALASISHVAHVTITTKTA
DGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNISTRRKALKNPSEEYGKILEVV
GRYSIHNAGISFSVKKQGETVADVRTLPSATTVDNIRSIFGNAVSRELIEVGCEDKALAF
SMRGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISP
QNVDVNVHPTKHEVHFLHEDSILERVQQHVESKLLGSNSSRTYFTQTLLPSLAGPSGEVV
KSTTRVTPSSVSGSGDKVYAHQMVRTDSREQKLDAFLQPGSKASQPQAIVPEDSTDASSA
RQRNEEMPELPAPVSVATRNESLERVATKGTSETAENRGSPSSPGNPRKRHREGSDVEMV
EDESQKEMTAACTPRRRIINLTSVLSLREEINERGHETLQEMLHNHSFVGCVNPQWALAQ
HQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGWTEEDG
PKEGLAEYIVQFLKRKTEMLADYFSLEIDEEGNLIGLPLLIDNYVPPLEGLPIFILRLAT
EVNWDEEKECFESLSKECAMFYSVRKQYISEESTLSGQQSEVPGSTPNSWKWTVEHVVYK
AFRSHLLPPKHFTEDGNILQLANLPDLYKVFERC
NT seq 2265 nt   +upstreamnt  +downstreamnt
atgtcgcttgcagcgggcgttattcggcggctggacgagacggtggtgaaccgcatcgcg
gcgggggaagtaatccagcggccggctaacgccatcaaggagatgattgagaactgttta
gatgcaaaatccacaagtattcaagtggttgtaaaagagggaggcctgaagttgattcag
atccaagacaatggtaccgggatcaggaaagaagatctggatattgtgtgtgagaggttc
actacaagtaaactgcagtcctttgaggatttagctaatatttctacttacggctttcgg
ggtgaggctttggccagcataagccatgtggcccacgttactattacaaccaaaacagct
gatgggaagtgcgcatacagagcaagttactcagatggaaaactgaaggctcctcctaaa
ccgtgtgcaggcaatcaagggacccagataacggtggaggaccttttttacaacatttcc
acgaggaggaaagctttaaaaaatccaagtgaagagtatgggaaaattctggaagtcgtt
ggcagatattcaatacacaatgcaggcattagtttctcagttaaaaaacaaggcgagaca
gtggccgacgttagaacgctgcccagcgccaccaccgtggacaatatccgctccatcttt
ggaaatgctgtgagccgagaactgatagaagttgggtgtgaagacaaagcactagccttc
agcatgagaggctacatctccaacgccaactactccgtgaagaaatgcatctttttactc
ttcatcaaccatcgtctggtagagtcaacttccttaagaaaagccattgaaacggtgtat
gcagcatatttgcccaaaaacacacacccgttcctgtacctcagtctagaaatcagtccc
cagaatgtggatgtcaatgtgcaccccacgaagcacgaagttcacttcttgcacgaggac
agcatcctggagcgggtgcagcagcacgtggagagcaagctgctgggctccaactcctcc
aggacgtacttcacccagactttactaccaagtcttgccggcccctctggggaggtggtt
aaatccacaacaagagtgaccccctcgtctgtttctggaagtggcgacaaggtctatgcc
caccagatggtccgtacagattcccgggagcagaagcttgatgcctttctgcagccgggg
agcaaggccagtcagccccaggccatcgtcccagaggacagcacagatgcctccagtgcc
aggcagcgaaatgaggaaatgcccgaactcccagctcctgtcagtgtggctaccaggaat
gagagtttggaaagggttgcaaccaaggggacttcagaaacggcagagaacagagggtcc
ccctccagcccgggcaaccccagaaagagacaccgggaaggctctgatgtggaaatggtg
gaagatgagtcccagaaggaaatgacagcagcttgtaccccccggagaaggatcattaac
ctcaccagtgtcctaagtctccgggaagaaattaatgagcggggacatgagactctgcag
gagatgctgcataaccactcctttgtgggctgtgtgaatcctcagtgggccttggcacag
catcagaccaagttataccttctcaacaccaccaaacttagtgaagaactgttctaccag
atactcatatatgactttgccaattttggtgttctgaggttgtcggagccagcaccgctc
tttgacctcgccatgctcgctttagatagtcccgagagtggctggacagaggaggatggt
cccaaagaaggacttgccgaatatattgttcagtttctgaaaaggaagactgagatgctc
gcagactacttctctttggagattgatgaggaagggaacctgattggattaccccttctg
atcgacaactatgtgcccccactagagggtctgccgatcttcattcttcgactagccact
gaggtgaactgggacgaagaaaaggaatgttttgaaagcctcagtaaagaatgtgctatg
ttttactccgtccggaaacagtatatatccgaggagtcaaccctctcaggccaacagagt
gaagtgcctggctccacgccaaactcctggaagtggactgtggaacacgttgtctataaa
gccttccgctcacacctcctgcctcctaagcatttcacagaagatggaaatatcctgcag
cttgccaacctgcccgatctatacaaagtctttgagaggtgttaa

DBGET integrated database retrieval system