KEGG   Miniopterus natalensis: 107526484
Entry
107526484         CDS       T05883                                 

Gene name
CA2
Definition
(RefSeq) carbonic anhydrase 2
  KO
K18245  carbonic anhydrase 2 [EC:4.2.1.1]
Organism
mna  Miniopterus natalensis
Pathway
mna00910  Nitrogen metabolism
mna01100  Metabolic pathways
mna04964  Proximal tubule bicarbonate reclamation
mna04966  Collecting duct acid secretion
mna04971  Gastric acid secretion
mna04972  Pancreatic secretion
mna04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    107526484 (CA2)
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    107526484 (CA2)
   04972 Pancreatic secretion
    107526484 (CA2)
   04976 Bile secretion
    107526484 (CA2)
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    107526484 (CA2)
   04966 Collecting duct acid secretion
    107526484 (CA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107526484 (CA2)
Enzymes [BR:mna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     107526484 (CA2)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107526484 (CA2)
SSDB
Motif
Pfam: Carb_anhydrase
Other DBs
NCBI-GeneID: 107526484
NCBI-ProteinID: XP_016054435
LinkDB
Position
Unknown
AA seq 287 aa
MATGPEWGAALAPDGRAAPRGPPAESRPSYLDLGETRKGPEHWHKDFPIAKGNRQSPVDI
DTKAAAYDPALKPLSISYEQATSRRILNNGHAFNVEFDDSQDKAVLKGGPLEGTYRLVQF
HFHWGSDDGHGSEHTVDKKKYAAELHLVHWNTKYKSFGDAVKQPDGLAVLGVFLEIGDDK
PGLQKVVDALGAIKTKGKSAAFTDFDPHGLLPNSLDYWTYPGSLTTPPLLECVTWIVLRE
PISVSSEQMMTFRQLSFHGEGEAEEPMVDNWRPAQPLHDRKVRASFK
NT seq 864 nt   +upstreamnt  +downstreamnt
atggccacagggcccgagtggggcgcagccttagctccagacgggagggcagctcctcgg
ggtcccccagctgaaagcagaccctcctacctggacctgggagagacgagaaaaggacct
gagcactggcacaaggactttcccatcgccaagggcaaccgccagtcccccgtggacatt
gacaccaaagcagcggcttacgaccccgcactgaagcccctgagcatctcctacgagcag
gcgacgtccaggaggatcctcaacaacggccacgctttcaacgtggagttcgacgactcc
caggacaaagcagtgctgaagggagggcccctggagggcacctaccgcctggtccagttc
cactttcactggggttcggacgatgggcatggctctgagcacactgtggataaaaagaaa
tatgccgcagagctgcacctggttcactggaacaccaagtacaagagtttcggggacgcc
gtgaagcaacccgatgggctggctgtgctgggcgtttttctggagatcggcgatgacaaa
cccggcctgcagaaggtggtcgacgcgctgggcgccatcaagacaaagggtaagagcgcc
gccttcaccgactttgacccccacgggctccttcccaacagcttggactactggacctac
cccggctccctgaccacgccgccgctcctggagtgcgtgacctggatcgtgctcagggag
cccatcagcgtgagcagtgagcagatgatgacgttccgacagcttagcttccacggggag
ggggaagccgaggagcccatggtggacaactggcgcccggcacagcccctgcacgaccgg
aaggtcagggcttccttcaaatga

DBGET integrated database retrieval system