KEGG   Miniopterus natalensis: 107526616
Entry
107526616         CDS       T05883                                 

Gene name
SLC26A4
Definition
(RefSeq) pendrin
  KO
K14702  solute carrier family 26 (sodium-independent chloride/iodide transporter), member 4
Organism
mna  Miniopterus natalensis
Pathway
mna04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    107526616 (SLC26A4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107526616 (SLC26A4)
   04147 Exosome [BR:mna04147]
    107526616 (SLC26A4)
Transporters [BR:mna02000]
 Solute carrier family (SLC)
  SLC26: Multifunctional anion exchanger
   107526616 (SLC26A4)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107526616 (SLC26A4)
SSDB
Motif
Pfam: Sulfate_transp STAS
Other DBs
NCBI-GeneID: 107526616
NCBI-ProteinID: XP_016054609
LinkDB
Position
Unknown
AA seq 779 aa
MEAPDRRSDPPGLPEYCGSYVVSRPVYSELAFQQRYERRLQERRTLRERLAQSCSCSRKR
ALGVLKSLLPILDWLPKYRVKEWLLSDIISGVSTGLVGTLQGMAYALLAAVPVGYGLYSA
FFPILTYFIFGTSRHISVGPFPVVSLMVGSVVLSLAPDENFLIPSNNGTISNATMIDNSA
RDAARILIASTLTLLVGIIQLVFGGLQIGFIVRYLADPLIGGFTTAAAFQVLVSQLKIIL
NVSTKNYNGILSIIYTLVDTFQNIGHTNLADFIAGLLTIIICMAVKELNDRFKHKIPVPI
PIEVIVTIIATAISYGANLEKNYNAGIVKSIPRGFLPPALPPVKLFSEMLTASFSIAVVA
YAIAVSVGKVYAIKYDYTIDGNQEFIAFGISNIFSGFFSCFVATTALSRTAVQESTGGKT
QIAGIISAGVVMIAIVALGKLLEPLQKSVLAAVVIANLKGMFMQVCDVPRLWRQNKIDAV
IWVFTCIVSIILGLDLGLLAGLIFGLLTVVLRVQFPSWNGLGSIPTTDIYKSTKNYKNIE
EPEGMKILRFSSPIFYGNVDGFKKCIKSTVGFDAIRVYNKRLKALRKIQKLIKKGQLRAT
KNGIISDVGSSNNAFEPDEDIEDPEELDIPTKEIEIQVDWNSEIPVKVNVPKVPIHSLVL
DCGAVSFLDVVGVRSLRVVVKEFQRIDVNVYFASLQDHVIEKLEKCGFFNDNRKDIFFLT
VHDAVLHVQNQVKSREIQDSILETISLIQDHKDPLELMEAELIEEELNVEDEAMRRLAS
NT seq 2340 nt   +upstreamnt  +downstreamnt
atggaagcgccggaccgcaggtcggatccgcccgggcttcctgagtactgcggcagctac
gtggtgtccaggcccgtctacagcgagctcgccttccagcagcgctacgagcggcgcctg
caggagcgcaggacgctgcgggagcgactggcccagagctgcagttgttcaagaaagaga
gcccttggtgtgctgaagagtctcttgcccatcttggactggcttcccaaataccgagtc
aaggaatggctgcttagtgacatcatttcaggagttagcactgggctagtaggtacactg
caaggcatggcgtatgctttactagctgcagttcctgttggatatggtctctactctgct
tttttccctatcctgacatactttatcttcggaacatcaagacacatctcagttggacct
ttcccagtggtcagtttaatggtgggatctgttgttctgagcctggccccagatgaaaac
tttctcatacccagcaacaatgggactatatcaaatgctaccatgatagacaactcggct
agagatgcagcaagaatattgattgcaagcacccttactcttttggttggaatcatacag
ttggtgtttgggggtttgcagattggattcatagtgaggtacttagctgatcctttgatt
ggtggattcacaacagctgctgcctttcaagtattggtctcacagctaaagatcatcctc
aatgtttcaaccaaaaactataatggaattctctccattatctatactctggttgacact
tttcaaaatattggtcacaccaatcttgctgatttcattgctggattactcaccattatc
atctgtatggcagttaaggaattaaatgatcgctttaaacacaaaatcccagtccctatt
cctattgaagtaattgtgacaataattgctactgccatttcatatggagccaacctggaa
aaaaattacaatgctggtattgttaaatccatcccaagggggttcttgcctcctgcactg
ccacctgtgaagttattttctgagatgctgactgcatcgttttccattgctgtggtggct
tatgctattgcagtgtctgtaggaaaagtatacgccatcaaatatgattacaccattgat
gggaaccaggaattcattgcctttgggatcagcaacatcttctccgggtttttctcttgt
tttgtggctaccaccgccctgtcccgcactgctgtccaggagagcactgggggaaaaaca
cagattgccggcatcatctcggctggggttgtgatgattgccatagttgccttggggaag
ctgctggagcccctgcagaagtcggtcttggcagctgttgtaattgccaacctgaaaggg
atgtttatgcaggtgtgtgacgttcctcgtctatggaggcagaacaagattgacgctgtt
atctgggtgtttacatgcatagtgtccatcattctggggctggaccttggtttactagct
ggccttatatttggattactgactgtggttctgagagttcagtttccctcctggaacggt
cttggaagcatccctaccacagacatctacaaaagtaccaagaactacaaaaatattgaa
gaacctgaaggaatgaagattcttaggttttctagtcctattttttatggcaacgtcgat
ggttttaaaaaatgtatcaagtctacagttggatttgatgccattagagtgtataataag
aggctgaaagcactgaggaaaatacagaaactcatcaaaaaagggcaattaagagcaaca
aagaatggcattataagtgacgttggttcatcaaataatgctttcgagcctgatgaagat
attgaagatccagaagaacttgatatcccaaccaaggaaatagagattcaagtggattgg
aattctgagattccagtgaaagtgaatgttccaaaagtgccaatccacagcctcgtgctt
gattgtggagctgtatctttcttggatgttgttggagtgaggtcactgagagtggttgtc
aaagaattccaaagaattgatgtaaatgtgtactttgcatcgcttcaagatcatgtaata
gaaaagctggagaaatgtggtttctttaatgataacagaaaggacatattctttttgact
gtccatgatgctgtcctccatgtacagaaccaggttaaatcccgagaaattcaagattcc
attttagaaacgatctccctcatccaagaccacaaagatcctcttgaattaatggaagca
gagctgattgaagaagaacttaatgttgaggatgaggctatgcgtagacttgcttcctga

DBGET integrated database retrieval system