KEGG   Miniopterus natalensis: 107526648
Entry
107526648         CDS       T05883                                 

Gene name
KCNMB4
Definition
(RefSeq) calcium-activated potassium channel subunit beta-4
  KO
K04941  potassium large conductance calcium-activated channel subfamily M beta member 4
Organism
mna  Miniopterus natalensis
Pathway
mna04022  cGMP-PKG signaling pathway
mna04270  Vascular smooth muscle contraction
mna04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    107526648 (KCNMB4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107526648 (KCNMB4)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107526648 (KCNMB4)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   107526648 (KCNMB4)
SSDB
Motif
Pfam: CaKB
Other DBs
NCBI-GeneID: 107526648
NCBI-ProteinID: XP_016054662
LinkDB
Position
Unknown
AA seq 193 aa
IRLGLFLIISGVVLLFIFGFCWLSPALQDLQATAANCTVLSVQQPGEVFECTFSCGADCR
GTAQYPCVQVYVNNSESNARALLHSDEHQLLTNPKCSYIPPCKRENQKNLESVMNWQQYW
KDEIGSQPFTCYFNQFQRPDDVLLHRTHDEIVLLHCFLWPLVTFVVGVLIVVLTICAKSL
AVKAEAMKKRKFS
NT seq 582 nt   +upstreamnt  +downstreamnt
atccggctcggcttgttcctcatcatctcgggcgtcgtgctgctcttcatcttcggcttc
tgctggctcagccccgcgctgcaggacctgcaagccacggcggccaactgcacggtgctg
tcggtgcagcagccgggcgaggtgttcgagtgcaccttcagctgcggcgccgactgccgg
ggcaccgcgcagtacccctgcgtgcaggtctacgtgaacaactccgagtccaacgccagg
gcgctgctgcacagcgacgagcaccagctgctcaccaaccccaagtgctcctatatccca
ccttgtaagagagaaaatcagaagaacttggaaagtgtcatgaattggcagcagtactgg
aaagatgagattggttcccagccatttacttgctattttaaccaatttcaaagaccagat
gacgtgctcctgcatcgcacacatgatgagattgtcctcctgcactgcttcctctggccc
ctggtgacatttgtggtgggtgttctcattgtggtcctgaccatctgtgccaagagcctg
gctgtcaaggcagaagccatgaagaagcgcaagttctcttag

KEGG   Miniopterus natalensis: 107540345
Entry
107540345         CDS       T05883                                 

Gene name
KCNMB1
Definition
(RefSeq) calcium-activated potassium channel subunit beta-1
  KO
K04937  potassium large conductance calcium-activated channel subfamily M beta member 1
Organism
mna  Miniopterus natalensis
Pathway
mna04022  cGMP-PKG signaling pathway
mna04270  Vascular smooth muscle contraction
mna04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    107540345 (KCNMB1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107540345 (KCNMB1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107540345 (KCNMB1)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   107540345 (KCNMB1)
SSDB
Motif
Pfam: CaKB CnrY COP23
Other DBs
NCBI-GeneID: 107540345
NCBI-ProteinID: XP_016072572
LinkDB
Position
Unknown
AA seq 191 aa
MGKKLVMAQKRGETRALCLGAAMVVCAVIAYYVLGTTMLPLYQKSVWTQESTCQLIETNI
RDQEELEGKKVAQYPCLWVNVSAVGRWAVLYHTEDTWDQNQQCSYIPGSLDNYQMARADV
EKVRDNFHKHQVFYCFSATRENETRVLYRRLYGPQTLLFSLFWPTFLLTGGLLIIAMVKV
NQSLSILAAQK
NT seq 576 nt   +upstreamnt  +downstreamnt
atggggaagaagctggtgatggcccagaagcggggagagactcgagccctctgcctggga
gcggccatggtggtgtgtgctgtcattgcctactatgtcctgggcacgaccatgctgccc
ctctaccagaaaagcgtgtggactcaggaatccacgtgccaactgattgagactaacatc
agggaccaggaggagctggagggcaagaaggtggcccagtacccgtgcctgtgggtcaac
gtgtccgccgtgggccgctgggcggtgctgtaccacacggaggacacttgggatcagaac
cagcagtgctcctacatcccaggcagcctggacaactaccagatggcccgggccgatgtg
gagaaagtcagagacaatttccacaagcaccaggtgttctactgcttctcggccacgcgc
gagaacgagaccagggtcctgtaccggcgcctctacggaccgcagaccttgctcttctct
ctcttctggccgaccttcctgctcaccgggggcctcctcatcatcgccatggtcaaggtc
aaccagtccctctccatcctggcggcccagaagtag

KEGG   Miniopterus natalensis: 107541085
Entry
107541085         CDS       T05883                                 

Gene name
KCNMB3
Definition
(RefSeq) calcium-activated potassium channel subunit beta-3
  KO
K04939  potassium large conductance calcium-activated channel subfamily M beta member 3
Organism
mna  Miniopterus natalensis
Pathway
mna04022  cGMP-PKG signaling pathway
mna04270  Vascular smooth muscle contraction
mna04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    107541085 (KCNMB3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107541085 (KCNMB3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107541085 (KCNMB3)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   107541085 (KCNMB3)
SSDB
Motif
Pfam: CaKB tRNA-synt_1g Cyt_bd_oxida_II OppC_N
Other DBs
NCBI-GeneID: 107541085
NCBI-ProteinID: XP_016073513
LinkDB
Position
Unknown
AA seq 312 aa
MASRWVASSLFTTLRWAANGIIPQPPGAGKCPHFFISLLKSLSSTSPHPRTAFSASEWKR
NTDHSDGDPPDGHRKLPSSAAEDRAVLLGFAMMGFAVLMFFLFGIAILQPFMLSPQREDA
NCTVIHTRLTDDGTDCAPTCGVGCQGQGRHPCLQVFVNLTHSGQKALLHYNEEAVQINSK
CFYTPKCHRDRDDLLNSALDIKEFFDHQNGTPFSCFYSPDSQAEDVILMKKYDRMVIFHC
LFWPSLTLLGGALIVGMVRLTQYLSLLCDKYSTASRGEAGGKAPYMERHWPTLWSVWRSQ
GRSRGISGWWPD
NT seq 939 nt   +upstreamnt  +downstreamnt
atggcatctcgttgggttgcatcgagcttgtttacgacccttaggtgggcagcaaatggg
atcatccctcaacccccaggggctggtaaatgtccccacttctttataagcttattgaaa
tctctctcctccacctccccccacccaaggacagccttttctgcctcagagtggaagaga
aatacagaccacagcgacggagacccacccgacgggcacaggaagctgccgtccagtgct
gcagaggacagagccgtgctgctggggttcgcgatgatgggcttcgcggttctgatgttc
ttcttgtttggaatagccatcctacagcccttcatgcttagccctcagagagaagacgcg
aactgcaccgtcattcacacacgcctcacggacgacgggacggactgtgctcccacctgc
ggcgtgggctgccaaggtcagggcaggcacccctgtctgcaggtgtttgtgaacctcacc
cattcaggtcagaaagctctcctacattataatgaagaggctgtccagataaattccaag
tgtttttacacacctaagtgccaccgagacagggatgacttgctcaacagtgctctggac
ataaaggaattcttcgatcaccaaaatgggacccccttctcgtgcttctacagcccagac
agccaagctgaagatgtgattctcatgaaaaagtatgaccgaatggttatcttccactgc
ttattttggccttcgctgactctgctaggtggcgccctgattgttggcatggtgcggtta
acacagtacctgtcccttctatgtgacaagtacagcactgcatccagaggtgaggcaggt
ggcaaagcaccttacatggaacggcactggcccacactgtggagtgtgtggagaagccaa
ggaaggagccgaggaatctcaggatggtggccagactga

KEGG   Miniopterus natalensis: 107541098
Entry
107541098         CDS       T05883                                 

Gene name
KCNMB2
Definition
(RefSeq) calcium-activated potassium channel subunit beta-2 isoform X1
  KO
K04938  potassium large conductance calcium-activated channel subfamily M beta member 2
Organism
mna  Miniopterus natalensis
Pathway
mna04022  cGMP-PKG signaling pathway
mna04270  Vascular smooth muscle contraction
mna04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    107541098 (KCNMB2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107541098 (KCNMB2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107541098 (KCNMB2)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   107541098 (KCNMB2)
SSDB
Motif
Pfam: CaKB KcnmB2_inactiv AAA_8 tRNA-synt_1g
Other DBs
NCBI-GeneID: 107541098
NCBI-ProteinID: XP_016073533
LinkDB
Position
Unknown
AA seq 264 aa
MATIHQRSFHHSSRTSTLRKGASGPTSSKMFIWTSGRTSSSYRHDEKRNIYQKIRDHDLL
DKRKTVTALKAGEDRAILLGLAMMVCSIMMYFLLGITLLRSYMQSVWTEESQCTLLNVSI
TETFNCSFSCGPDCWKLSQYPCLQVYVNLTSSGEKFLLYHTEETMKINQKCSYIPKCGKN
FEESMSLVNVVMENFRKYQHFSCYSDPEGNQKSVILTKLYSSNVLFHSLFWPTCMMAGGV
VIVAMVKLTQYLSLLCDRIQRINR
NT seq 795 nt   +upstreamnt  +downstreamnt
atggccaccatacatcaaaggtcttttcaccattcctccaggacttccaccctaaggaaa
ggagcctctggaccaacatcctctaagatgtttatatggaccagcggccggacctcttca
tcttacagacacgatgagaaaagaaatatttaccaaaaaatcagggaccacgacctcttg
gacaaaaggaaaacggtcacagcgctgaaagcaggagaggaccgggccatcctgctgggc
ctggccatgatggtgtgctccatcatgatgtactttctgctgggaatcacactcctgcgc
tcatacatgcagagtgtgtggaccgaagagtctcaatgcaccttgctgaatgtgtccatt
acggaaacatttaactgctccttcagctgtggcccggactgctggaagctctctcagtac
ccctgcctccaggtgtacgttaacctgacttcttcgggtgaaaagttccttctctaccac
accgaagagacgatgaaaatcaatcagaagtgctcctatatacctaagtgtggaaaaaat
tttgaagaatccatgtccctggtgaatgtcgtcatggaaaacttcaggaagtaccaacac
ttttcctgctattctgacccagaaggaaaccagaagagcgtcatcctaaccaaactctac
agttccaacgtgctgttccattcactcttctggcccacgtgtatgatggctgggggcgtg
gtgatcgtcgccatggtgaagctcacacagtacctctccctgctctgtgacaggatccaa
cggatcaatagataa

KEGG   Miniopterus natalensis: 107545799
Entry
107545799         CDS       T05883                                 

Gene name
KCNMA1
Definition
(RefSeq) calcium-activated potassium channel subunit alpha-1
  KO
K04936  potassium large conductance calcium-activated channel subfamily M alpha member 1
Organism
mna  Miniopterus natalensis
Pathway
mna04022  cGMP-PKG signaling pathway
mna04270  Vascular smooth muscle contraction
mna04911  Insulin secretion
mna04924  Renin secretion
mna04970  Salivary secretion
mna04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    107545799 (KCNMA1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107545799 (KCNMA1)
   04924 Renin secretion
    107545799 (KCNMA1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107545799 (KCNMA1)
  09154 Digestive system
   04970 Salivary secretion
    107545799 (KCNMA1)
   04972 Pancreatic secretion
    107545799 (KCNMA1)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   107545799 (KCNMA1)
SSDB
Motif
Pfam: BK_channel_a Ion_trans Ion_trans_2 TrkA_N Lig_chan
Other DBs
NCBI-GeneID: 107545799
NCBI-ProteinID: XP_016079491
LinkDB
Position
Unknown
AA seq 1162 aa
MSSNIHANHLSLDASSSSSSSSSSSSSSSSVHEPKMDALIIPVTMEVPCDSRGQRMWWAF
LASSMVTFFGGLFIILLWRTLKYLYSHTPLPSTFWGICILAPTPPPEAQKINNGSGQADG
TLKPVDEKEEVVAAEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSS
NPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFV
SVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHL
VENSGDPWENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMF
ASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEI
VFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDA
EDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIA
QSCLAQGLSTMLANLFSMRSFIKIEEDTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCE
LCFVKLKLLMIAIEYKSANRESRSRKRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFY
CKACHDDITDPKRIKKCGCKRLEDEQPSTLSPKKKQRNGGMRNSPSSSPKLMRHDPLLIP
GNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSAL
IGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRA
VNINLCDMCVILSANQNNIDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGM
DRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFAC
GTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLAN
RDRCRVAQLALLDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRLRDAHLSTPSQCTKR
YVITNPPYEFELVPTDLIFCLMQFDHNAGQSRASLSHSSHSSQSSSKKSSSVHSIPSTAN
RPNRPKSRESRDKQKYVQEERL
NT seq 3489 nt   +upstreamnt  +downstreamnt
atgagcagcaatatccacgcgaaccatctcagcctagacgcgtcctcctcctcctcctcc
tcttcatcctcctcttcctcctcgtcctcggtccacgagcccaagatggatgcgctcatc
atcccggtgaccatggaggtgccgtgcgacagccggggccagcgcatgtggtgggctttc
ctggcctcctccatggtgactttcttcgggggcctcttcatcatcctgctctggcggacg
ctcaagtacctatattctcatactcccctcccctccacgttctggggcatctgcattctc
gcccccacgccaccccctgaggcccagaagattaacaatggctccggccaggccgatggc
actctcaagccagtggacgagaaggaggaggtggtggcagccgaggtcggctggatgacc
tctgtcaaggactgggcgggggtgatgatatctgcccagacgctgaccggcagagtcctg
gttgtcttagtctttgctctcagcattggtgcacttgtaatatacttcatagattcgtca
aacccaatagaatcctgccagaatttctacaaagatttcacattacagatcgacatggct
ttcaacgtgttcttcctgctctactttggcttgcggtttattgcagccaacgacaagctg
tggttctggctggaagtgaactctgtcgtggatttcttcacggtccccccagtgtttgtg
tctgtgtacttaaacagaagttggcttggtttgagatttttacgagctctcagactgatc
cagttttcagaaatcttgcagtttctgaatatccttaaaacaagtaattccatcaagctg
gtgaatctgctctccatatttatcagcacgtggctcacagcagccgggttcatccatttg
gtggagaattcaggggacccatgggaaaatttccaaaacaaccaggctcttacctactgg
gaatgtgtctacttactcatggtcaccatgtccactgtcggctacggggacgtttatgcg
aaaaccacgctcgggcgcctcttcatggtcttcttcatcctcgggggactggccatgttt
gccagctacgtccctgaaatcatagagttaataggaaaccgcaagaaatacgggggctcc
tatagtgcggttagtggaagaaagcacattgtggtctgtggacacatcactcttgagagc
gtctccaacttcctgaaggactttctgcacaaggaccgggacgatgtcaacgtggagatc
gtctttcttcacaacatttcccccaacctggagcttgaagctctgttcaaacgacatttt
actcaggtggaattttatcagggttcagtcctcaatccacacgatcttgcgagagtcaag
atagagtcagcagacgcgtgcctcatccttgccaataagtactgcgctgaccctgacgct
gaagatgcctccaacatcatgagagtaatctccataaagaactaccacccgaagataaga
atcatcactcagatgctgcagtatcacaacaaggcccatctgctaaacatcccaagctgg
aattggaaagagggcgatgatgcaatctgcctcgcggagctgaagctggggttcatagcc
cagagctgcctggctcagggcctctccaccatgctcgccaacctcttctccatgaggtca
ttcataaagattgaggaagacacgtggcagaaatactacttggaaggagtctcgaatgaa
atgtacacagaatatctctccagtgccttcgtgggtctgtccttccctactgtttgtgag
ctgtgttttgtgaagctcaagctcctaatgatagccattgagtacaagtccgccaaccga
gagagccgaagccgaaagcgtatattaattaatcccggaaaccatcttaagatccaagaa
ggtactttaggatttttcatcgcaagtgatgccaaagaagttaaaagggcatttttttac
tgcaaggcctgtcatgatgacatcacagatcccaaaaggataaaaaaatgcggctgcaaa
cggcttgaagatgagcagccctcaacgctgtcaccaaaaaaaaagcagcggaatggaggc
atgcggaactcccccagctcctcgcccaagctgatgaggcacgaccccttgttaattccc
ggcaacgatcagattgacaacatggactccaacgtgaagaagtatgactctacggggatg
tttcactggtgcgcgcccaaggagatagagaaagtcatcctgacgcgaagtgaagccgcc
atgaccgtcctgagcggccacgtcgtggtctgcatcttcggcgacgtcagctcggccctg
attggcctccggaacctggtgatgccactccgtgccagcaactttcactaccacgagctc
aagcacatcgtgttcgtgggctccatcgagtacctcaagcgggaatgggagacgctgcat
aacttccccaaagtgtccatattgcccggtacgccattaagtcgggctgatttaagggcc
gtcaacatcaacctctgtgacatgtgcgtcatcctgtcagccaatcagaataatattgat
gacacttcgctgcaggacaaggagtgcatcttggcgtcactcaacatcaaatctatgcag
tttgatgacagcatcggggtcttgcaggctaactcccaagggttcacacctccaggaatg
gacagatcctcgccagacaacagcccagtgcacgggatgttacgtcagccgtccatcacg
acgggggtcaacatccccatcatcactgaactagtgaacgatactaatgttcagtttttg
gaccaagacgatgacgatgaccccgacacagaactgtacctcacgcagccatttgcatgc
gggacagcatttgccgtcagcgtcctggactcgctcatgagcgcgacatactttaatgac
aatatccttaccttgatccggaccctggtgacgggaggagccacgcctgagctcgaggct
ctgattgcggaggagaatgcccttcgagggggctacagcaccccgcagacactggccaac
agggaccgctgccgcgtggcccagttagcgctgctggatgggccctttgcggacttgggg
gatggtggttgttatggtgatctgttctgcaaagctctgaaaacgtataatatgctttgt
tttggaatttaccgactgagagatgctcacctcagcacccccagccaatgcacaaagagg
tatgtcatcaccaaccccccgtatgagtttgagctcgtgccgacggacctgatcttctgc
ttaatgcagtttgaccacaacgccggccagtcccgggccagcctctcccattcctcccac
tcgtcccagtcctccagcaagaagagctcctccgtccactccatcccgtccacggccaac
cgaccgaaccggcccaagtcccgggagtcccgagacaaacagaagtacgtgcaggaagag
cggctctga

DBGET integrated database retrieval system