KEGG   Miniopterus natalensis: 107526670
Entry
107526670         CDS       T05883                                 

Gene name
TPO
Definition
(RefSeq) thyroid peroxidase
  KO
K00431  thyroid peroxidase [EC:1.11.1.8]
Organism
mna  Miniopterus natalensis
Pathway
mna00350  Tyrosine metabolism
mna01100  Metabolic pathways
mna04918  Thyroid hormone synthesis
mna05320  Autoimmune thyroid disease
Module
mna_M00043  Thyroid hormone biosynthesis, tyrosine => triiodothyronine/thyroxine
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    107526670 (TPO)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    107526670 (TPO)
 09160 Human Diseases
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107526670 (TPO)
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.8  iodide peroxidase
     107526670 (TPO)
SSDB
Motif
Pfam: An_peroxidase EGF_CA EGF_3 cEGF Sushi FXa_inhibition hEGF EGF
Other DBs
NCBI-GeneID: 107526670
NCBI-ProteinID: XP_016054683
LinkDB
Position
Unknown
AA seq 922 aa
MRALAVLGITLVVACSQVIFILMRGRDLLWGKSEDSHVLRVLEESKLRVDSAIDSTVTRN
LRKREIVSPSQLLSFSKLPEDXEPTSRAISRAAEIMEASVQAMRREHPKQPRPPADALSE
ELLNTIANLSGCLAHMLPPQCPDTCLADRYRLVTGACNNRDHPRWGAANVALARWLPPAY
EDGISEPRGWNLNFLYNGVPLPPVREVTRQVIQVSNEAVTEDDRYSDLLTVWGQYIGHDI
AFTPQSTSEAAFGGGSGCQLSCENRNPCFPIQLPENTSPTAGATCLPFYRSSAACGTGAQ
GALFGNLSTGNPRQQMNGLTSFLDASTVYGSSPALEKQLRNWSSAEGLLRVNSRHWDAGR
AYLPFVSPRAPSACIPEPGAQGRVPCFLAGDNRASEVPPLTALHTLWLREHNRLATALKA
LNPHWSADTAYQEARKVVGALHQIITLRDYVPKILGPEAFRQHVGPYEGYNSTMDPTVSN
VFSTAAFRFGHTTVHPLVRRLDAHFQELLPPLLLRDAFFSPWRVLKEGGLDPLVRGLLAR
PAKLQVQGQLMSEELTERLFVLSPAGTFDLASLNLQRGRDHGLPGYNDWREFCGLPRLLT
RDDLSSVIANGSITDRIMGLYKHLDNIDVWLGGLVEALLPSARTGPLFACIIGRQMKALR
DGDRFWWEHSGVFTEAQRQELDKHSLSRVICDNTGLPRVPPDSFRVASFPQDFQPCEDVP
GLSLEAWREAAPPEEACGFPGSVENGDFVLCGDPGRPVLVFSCRHGFRLQGREQLTCSPH
GWDFPPPVCKDVDECEDPREPPCHPSARCRNTKGSFRCECADPYVLGEDGRTCVDSGRLP
RASLVSIVLGALLVCGLAAFTWTLIWRWTHCDSKSSLPITERDGKSASPSGCRRRQDPSV
SLCGAPAQGSEQSLLGAGDEGQ
NT seq 2769 nt   +upstreamnt  +downstreamnt
atgcgagcgctggccgtcctgggcatcacgctggttgtggcctgcagccaagtcatcttc
attctcatgaggggcagggacctcctctgggggaagtccgaagactctcacgtgctccgc
gtcctggaggagagcaagctccgcgtggactctgccatcgacagcaccgtgacaaggaac
ctcaggaaaagagaaatcgtttctccgtctcagcttctgtctttttccaaactccctgaa
gatcntgagcccacgagccgagccatctcccgagcagcagagatcatggaggcgtcggtg
caggcgatgaggagggagcaccccaaacagccacggcctccggcagatgctctgtcagaa
gagctgctgaacaccattgccaacctgtcggggtgcctggcccacatgctgcccccccag
tgtccggacacctgcctggcggacaggtaccggctcgtcacgggagcctgcaacaacaga
gaccaccccaggtggggcgccgccaacgtggccctggccagatggctgccgcctgcctat
gaagatggcatcagcgagccccgaggctggaacctcaacttcttatacaacggggttccc
ctgcccccagtccgggaggtaacaaggcaggttatccaggtttctaacgaggccgtgaca
gaggatgaccgatactcggatctgctgacggtgtgggggcaatacatcggccacgacatt
gcgttcacgccgcagagcaccagtgaggctgccttcgggggagggtctggctgccagctg
agctgcgagaaccggaatccgtgttttcccatccagctccctgagaacacctcaccgacc
gctggcgccacctgcctgcccttctaccggtcgtccgccgcctgtggcaccggggcccaa
ggcgccttgtttggcaacctatccacggggaacccgcgacaacagatgaacgggctgacc
tctttcctggacgcgtccactgtgtacggcagctccccggccctggagaagcagctgcgg
aactggagcagcgcggaggggctgctccgggtcaactcgcgccactgggacgccggccgg
gcctacctgcccttcgtctcgccacgcgcgccctcagcctgcatcccggagccgggcgcc
cagggccgcgtgccctgcttcctggctggggacaaccgagccagcgaggtccccccgctg
acggccctgcacacgctgtggctgcgggagcacaaccgtctggccaccgcgctcaaggcc
ctcaacccgcactggagcgcggacaccgcctaccaggaggcacggaaggttgtgggcgcc
ctgcaccagatcattaccttgcgagattatgtccccaaaatcctgggccccgaggccttc
aggcagcacgtgggcccctatgagggctacaactccaccatggaccccacggtgtccaac
gtgttctccacggccgccttccgcttcggccacaccacagtccacccgctggtgagacgg
ctggatgcccacttccaggagctcctgcccccgctgctgctgcgagacgctttcttcagc
ccctggagggtcctcaaggaaggtggtttggaccccctggtgcggggcctcctcgccagg
ccggccaagctgcaggtgcagggccagctgatgagcgaggagctgaccgagaggctcttt
gtgctttcccccgcggggaccttcgacctggcctcgctgaacctgcagcggggccgggac
cacggcctgccaggttacaacgactggagggagttctgcggcctgccccggctgctcacc
cgggacgacctgagtagcgtcattgccaacgggagcatcactgaccggataatgggcttg
tacaagcacctggataacatcgacgtctggctgggtggcttggtggaggccttgctgccg
agtgctcgaacggggcccctgtttgcctgcatcatcgggagacagatgaaggccctgagg
gacggggaccggttttggtgggaacacagcggggtgttcacggaggcgcagaggcaggag
ctggacaagcactccctgtcccgggtcatctgcgacaacacgggcctcccccgcgtgccc
cccgattccttccgagttgcaagcttcccccaggacttccagccgtgcgaggacgtcccc
ggcctgagcctggaagcgtggagggaggcggctcccccagaggaggcctgcggcttcccg
gggagcgtggagaacggggacttcgtgctctgcggggacccgggacgacctgtgctggtg
ttttcctgtcgccacgggttccggctccagggccgggagcagctcacgtgctccccccat
ggctgggacttcccgccccccgtgtgtaaagacgtcgacgagtgcgaggacccgagggag
ccgccctgccacccctcagcccgctgcaggaacaccaagggcagcttccggtgcgagtgc
gctgacccctacgtgctgggagaggacgggaggacctgcgtagactcggggaggctccca
agggcatccttggtgtccatcgtgctgggcgccctgctggtctgcggcctggcagccttc
acctggacgctgatctggaggtggacacactgtgactccaagtcctcactgccgatcacg
gagagagatggaaagtcagcctccccgtcgggctgcaggaggcgccaggacccgagcgtg
tcgctgtgcggagcccccgcccagggctcggagcagagcctgctgggggcaggtgacgag
ggacagtga

DBGET integrated database retrieval system