KEGG   Miniopterus natalensis: 107526767
Entry
107526767         CDS       T05883                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2B31-like
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
mna  Miniopterus natalensis
Pathway
mna00040  Pentose and glucuronate interconversions
mna00053  Ascorbate and aldarate metabolism
mna00140  Steroid hormone biosynthesis
mna00830  Retinol metabolism
mna00860  Porphyrin and chlorophyll metabolism
mna00980  Metabolism of xenobiotics by cytochrome P450
mna00982  Drug metabolism - cytochrome P450
mna00983  Drug metabolism - other enzymes
mna01100  Metabolic pathways
mna01240  Biosynthesis of cofactors
mna04976  Bile secretion
mna05204  Chemical carcinogenesis
Module
mna_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    107526767
   00053 Ascorbate and aldarate metabolism
    107526767
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    107526767
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    107526767
   00860 Porphyrin and chlorophyll metabolism
    107526767
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    107526767
   00982 Drug metabolism - cytochrome P450
    107526767
   00983 Drug metabolism - other enzymes
    107526767
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    107526767
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    107526767
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mna01003]
    107526767
Enzymes [BR:mna01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     107526767
Glycosyltransferases [BR:mna01003]
 Others
  Hydrophobic molecule
   107526767
SSDB
Motif
Pfam: UDPGT Glyco_transf_4 Glyco_trans_4_4
Other DBs
NCBI-GeneID: 107526767
NCBI-ProteinID: XP_016054818
LinkDB
Position
Unknown
AA seq 309 aa
MNHGKRDQPFEKKHCSTRMPTKWISVLLLLQLSCHIRPGWCGKVLVWPTEYSHWMNMKTI
LDELVHRGHEVTVLTSSASILVVPNKASAIKFEIFPTSLTKDDFELFFMQLINKWTYDLP
KHRFWTHFSLMQEMFWEGSEFAEKLCKDAVLNRKLMTKLQESRFDVVLADAVGPCGELLA
ELLKIPLVYSLRFSPGYTIEKYSGGLPFPPSYVPVVLSGLSDQMTFMERVENMIYVLYFD
FWFQTYNQKKWDQFIREVLGRPTTLYELKSKAEMWLIRTYWDFEFPHPLLPHFEFVGGLH
CKPAKPLPK
NT seq 927 nt   +upstreamnt  +downstreamnt
atgaaccatggtaaaagggaccagccatttgaaaagaaacactgctccaccaggatgcct
acgaagtggatttccgttctgctgctgctacagctgagctgtcacattcgccctgggtgg
tgtggaaaggtgctggtgtggcccacagaatatagccattggatgaatatgaagacaatc
ctggatgaacttgtccacagaggtcatgaagtaactgttctgacatcttcagcttcaatt
cttgttgttcccaataaggcatctgctattaaatttgagatttttcctacatctttaaca
aaagatgatttcgaattatttttcatgcagctaatcaataaatggacatatgatctacca
aaacatagattttggacacatttttcactaatgcaagaaatgttttgggaaggttctgaa
tttgctgaaaagctctgcaaagatgctgttttaaataggaaacttatgacaaaactacag
gaatcaaggtttgatgtcgttcttgcagacgccgttggaccctgtggtgagctgctggca
gaactacttaaaatacctttggtgtacagtctccgcttctctccgggctacacaattgaa
aagtatagcggaggacttccattccctccgtcctacgtacctgttgtcttgtcaggatta
agtgatcagatgaccttcatggagagggtagaaaatatgatatacgtgctctattttgac
ttctggttccaaacatataatcagaagaagtgggatcagtttatcagagaagtactagga
agacccaccacattatatgagttaaagagtaaagctgaaatgtggctcattcgaacctat
tgggattttgagtttccccacccactcttgccacattttgaatttgttggaggcctccac
tgcaaacctgctaagcctctgcctaag

KEGG   Miniopterus natalensis: 107530731
Entry
107530731         CDS       T05883                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 1-1-like
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
mna  Miniopterus natalensis
Pathway
mna00040  Pentose and glucuronate interconversions
mna00053  Ascorbate and aldarate metabolism
mna00140  Steroid hormone biosynthesis
mna00830  Retinol metabolism
mna00860  Porphyrin and chlorophyll metabolism
mna00980  Metabolism of xenobiotics by cytochrome P450
mna00982  Drug metabolism - cytochrome P450
mna00983  Drug metabolism - other enzymes
mna01100  Metabolic pathways
mna01240  Biosynthesis of cofactors
mna04976  Bile secretion
mna05204  Chemical carcinogenesis
Module
mna_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    107530731
   00053 Ascorbate and aldarate metabolism
    107530731
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    107530731
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    107530731
   00860 Porphyrin and chlorophyll metabolism
    107530731
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    107530731
   00982 Drug metabolism - cytochrome P450
    107530731
   00983 Drug metabolism - other enzymes
    107530731
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    107530731
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    107530731
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mna01003]
    107530731
Enzymes [BR:mna01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     107530731
Glycosyltransferases [BR:mna01003]
 Others
  Hydrophobic molecule
   107530731
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C Zeta_toxin Glyco_transf_4
Other DBs
NCBI-GeneID: 107530731
NCBI-ProteinID: XP_016060111
LinkDB
Position
Unknown
AA seq 533 aa
MAAGPRGPRPLLLGLLLCALGPAVSRGGRLLLVPMDGSHWLSLRGVIQQLQQRGHDIVVL
APEASMHIREGAFYTLKTYPVPFRREDVEATFISLGHNVFENEPFLQRVIKKYKKVQKDS
AMLLSGCSHLLHNKELMASLAESRFDAVLTDPFLPCGSIVAQYLALPVIFFLNALPCSLD
SQGTQCPNPPSYVPRPLSLNSDRMTFLQRVRNMLMALTENFLCNVVYSPYGSLASEVLQK
EVTVQDLMSSASIWLLRTDFVKSYPRPIMPNMVFIGGINCAGKKPLSQEFEAYINASGEH
GIVVFSLGSMVSEIPESKAMQIADALGKIPQTVLWRYTGTRPSNLAKNTILFKWLPQNDL
LGHPKTRAFITHSGSHSIYEGICNGVPMVMLPLFGDQMDNAKRMESRGAGVSLDVLEMTS
EDLANALKTVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHD
LTWYQYHSLDVIGFLSAVVLGAVLVVYKCCAFGCRRCFGKKKRAKKSNKSKAH
NT seq 1602 nt   +upstreamnt  +downstreamnt
atggcagcagggcctcggggtccgcgtcctctcctcctgggcctgctgctgtgcgcgctc
ggcccggccgtgtcccggggcgggaggctgctgttggtccccatggacggcagccactgg
ctgagcttgagaggcgtcatccagcagctgcagcagaggggacatgacatcgtggtcctg
gcgcccgaggcctcgatgcacatcagggaaggagcgttttataccttgaagacctacccc
gtgcccttccgaagggaggacgtggaagcgactttcatcagcctcgggcacaacgtgttc
gagaacgagcctttcctgcagcgtgtgatcaagaagtacaagaaggtccagaaggactcg
gccatgctcttgtcggggtgctcccacctcctgcacaacaaggagctgatggcctcgctg
gccgaaagccgtttcgacgccgtgctgaccgaccccttccttccctgcggctccatcgtg
gcccagtacctggccctgcctgtcatcttcttcctgaacgcgctgccctgcagcctggac
tctcagggtacccagtgccccaacccgccatcctatgtgcccaggcccctgtccttaaac
tcagaccgcatgaccttcctgcagcgggtcaggaacatgctcatggccttgaccgagaac
tttctctgcaatgtggtttattccccgtatgggtccctggcctcggaagtccttcagaaa
gaggtgacagtccaggacctcatgagctctgcgtccatctggcttctcagaaccgacttt
gtgaagagttaccccaggcccatcatgcccaatatggtttttattggtggaatcaactgc
gctggcaaaaagccattatcccaggaatttgaagcctacataaacgcctctggagagcac
gggatcgtggttttctctttgggctcaatggtctcggagattcccgagagcaaggcgatg
caaattgctgacgcgttgggcaaaatacctcagacggtcctgtggcggtacaccgggacc
cggccgtcgaacctcgcgaagaataccatcctcttcaagtggctgccccagaacgatctg
cttggtcaccccaagacgcgcgcctttatcacacactctggctcccacagtatctatgaa
ggaatatgcaacggcgtccccatggtcatgctgcccctgttcggtgatcagatggacaat
gccaagcgcatggagtcccggggagcgggagtgtccttggacgtcctggaaatgacttcc
gaagacttagcaaatgccctcaaaacggtcatcaatgacaaaagctacaaggaaaacatc
atgcgcctctccagcctccacaaggaccggcccgtggagccactggacctggctgtgttc
tgggtggagttcgtcatgaggcacaagggagccccgcacctgcggcccgcggcccacgac
ctcacctggtaccagtaccattccctggacgtgataggcttcctctcggccgtggtgctg
ggggccgtcctcgttgtctacaaatgctgtgccttcggctgccgcagatgctttgggaaa
aagaagcgagctaagaaatctaacaagtccaaggcgcactga

KEGG   Miniopterus natalensis: 107530733
Entry
107530733         CDS       T05883                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 1-10-like
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
mna  Miniopterus natalensis
Pathway
mna00040  Pentose and glucuronate interconversions
mna00053  Ascorbate and aldarate metabolism
mna00140  Steroid hormone biosynthesis
mna00830  Retinol metabolism
mna00860  Porphyrin and chlorophyll metabolism
mna00980  Metabolism of xenobiotics by cytochrome P450
mna00982  Drug metabolism - cytochrome P450
mna00983  Drug metabolism - other enzymes
mna01100  Metabolic pathways
mna01240  Biosynthesis of cofactors
mna04976  Bile secretion
mna05204  Chemical carcinogenesis
Module
mna_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    107530733
   00053 Ascorbate and aldarate metabolism
    107530733
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    107530733
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    107530733
   00860 Porphyrin and chlorophyll metabolism
    107530733
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    107530733
   00982 Drug metabolism - cytochrome P450
    107530733
   00983 Drug metabolism - other enzymes
    107530733
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    107530733
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    107530733
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mna01003]
    107530733
Enzymes [BR:mna01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     107530733
Glycosyltransferases [BR:mna01003]
 Others
  Hydrophobic molecule
   107530733
SSDB
Motif
Pfam: UDPGT Glyco_transf_4 Glyco_transf_5 Glyco_trans_4_2
Other DBs
NCBI-GeneID: 107530733
NCBI-ProteinID: XP_016060114
LinkDB
Position
Unknown
AA seq 308 aa
MAPAAWTGLPLCLCLLLAPGCAQAGKLLVIPMDGSHWFTMRSVVEQLAHRGHEVVVVKPE
VSWQLRQSSNYTMKSYSSSYTLEDLNHQFWVFSEAQWKTRVQDVHSLLLSPSNGIFDFFF
SHCRSLFNDKKLVKYIEDGAFDAVFLDPFDLCGLIVAKYFSLPSVVFTRGVFCHYLEEGT
RCPSPASYVPRGFSALSDTMTFRERVRNHVIQLEEHLICHYFFKTGLEVASEILQTTVTA
SDLFSQPSIWLIRSDFVFDYPRPVMPNMIFIGGINCHPGKPLSQVSCPSFPLLRITWLGR
ERKAEIPH
NT seq 927 nt   +upstreamnt  +downstreamnt
atggctcccgcggcgtggacgggcctccctctgtgcctgtgcctcctgctggcacccggc
tgcgcccaggcgggcaagctgctggtcatccccatggacgggagccactggttcaccatg
cgctctgtcgtggagcagctcgcccacagagggcatgaggtggtcgtggtcaagccagag
gtgagttggcaactgagacagtcatccaattacaccatgaagagttattcctcttcttac
accctagaggatttgaatcaccagttctgggttttctctgaggctcagtggaaaactcgg
gtgcaagatgtacattctttgctattgagcccatccaacggtatttttgatttttttttc
tcacactgtagaagtttgttcaacgacaaaaaattagtaaaatacatagaagatggtgct
ttcgatgcagtgtttctagatccttttgacctgtgtggcttgatcgtggccaaatatttt
tcactgccctccgtggtcttcaccaggggcgtgttttgccactatcttgaagaagggacc
cggtgccccagccctgcttcctacgttcccaggggcttctccgcgctatcggacaccatg
accttcagggagagagtgcggaaccacgttatccaactggaggaacatttaatttgtcac
tattttttcaaaactggtttggaagtcgcctctgagattctccagaccactgtgacagcc
agtgaccttttcagccaaccatccatttggttgatacggagtgactttgttttcgactat
cccagacctgtgatgcccaacatgatcttcattggcggcatcaactgccacccgggaaag
ccactgtcacaggtgagttgcccatcctttcccctgctcaggataacctggcttggtcgt
gaaaggaaagcagagattccgcactga

KEGG   Miniopterus natalensis: 107541922
Entry
107541922         CDS       T05883                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2B31-like
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
mna  Miniopterus natalensis
Pathway
mna00040  Pentose and glucuronate interconversions
mna00053  Ascorbate and aldarate metabolism
mna00140  Steroid hormone biosynthesis
mna00830  Retinol metabolism
mna00860  Porphyrin and chlorophyll metabolism
mna00980  Metabolism of xenobiotics by cytochrome P450
mna00982  Drug metabolism - cytochrome P450
mna00983  Drug metabolism - other enzymes
mna01100  Metabolic pathways
mna01240  Biosynthesis of cofactors
mna04976  Bile secretion
mna05204  Chemical carcinogenesis
Module
mna_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    107541922
   00053 Ascorbate and aldarate metabolism
    107541922
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    107541922
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    107541922
   00860 Porphyrin and chlorophyll metabolism
    107541922
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    107541922
   00982 Drug metabolism - cytochrome P450
    107541922
   00983 Drug metabolism - other enzymes
    107541922
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    107541922
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    107541922
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mna01003]
    107541922
Enzymes [BR:mna01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     107541922
Glycosyltransferases [BR:mna01003]
 Others
  Hydrophobic molecule
   107541922
SSDB
Motif
Pfam: UDPGT Glyco_transf_4
Other DBs
NCBI-GeneID: 107541922
NCBI-ProteinID: XP_016074592
LinkDB
Position
Unknown
AA seq 290 aa
MPTKWISVLLLLQLGCHFSPGWCGKVLVWPTEYSHWMNMKIILDELVHRGHEVTVLTSSA
SILVDPNKASAINFEIFPTSLTKDDFEDLFMQLISKWTNTPKDGFFTYFSLMQDIFGEYY
DYIQKLCKDAVLNKKLMTKLQESRFDVILADPFGPCGELLAEVLKIPLVYSLRFTPGSTI
EKHIGGLPFPPSYAPVVLSELSDQMTFMERVKNMIYVLYFDFWFQTYNQKKWDQLYTEVL
GRPTTLFELMSKAEIWLIRTYWDFEFPRPFLPHFHFVGGLHCKPAKPLPK
NT seq 870 nt   +upstreamnt  +downstreamnt
atgcctacgaagtggatttccgttctgctgctgctacaactgggttgtcactttagccct
gggtggtgtggaaaggtgctggtgtggcccacagaatatagccattggatgaatatgaag
ataattctggatgaacttgtccacagaggtcatgaagtgactgttctgacatcttcagct
tcaattcttgttgatcccaataaggcatctgctattaattttgagatttttcctacatct
ttaacaaaagatgattttgaggatcttttcatgcagctgatctctaaatggacaaataca
ccaaaagatggcttttttacttatttttcactaatgcaagatatctttggggaatattat
gattacattcagaagctctgtaaagatgcagttttaaacaagaaactgatgacaaaacta
caggaatcaaggtttgatgtcattcttgcagacccctttggaccctgtggtgagctgctg
gctgaagtacttaaaatacctttggtgtacagtctccgcttcactccaggctctacaatt
gagaagcatattggaggacttccattccctccgtcctatgcacctgttgtcttgtcagag
ttaagtgatcaaatgaccttcatggagagggtaaaaaatatgatatacgtgctctatttt
gacttctggttccaaacatataatcagaagaagtgggaccagttatatactgaggtacta
ggaagacccactacattatttgaattaatgagtaaagctgaaatatggctcattcggacc
tactgggactttgaatttccccgcccattcttaccacatttccattttgttggaggcctc
cactgcaaacctgccaaacctctgcctaag

KEGG   Miniopterus natalensis: 107541929
Entry
107541929         CDS       T05883                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2A2 isoform X1
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
mna  Miniopterus natalensis
Pathway
mna00040  Pentose and glucuronate interconversions
mna00053  Ascorbate and aldarate metabolism
mna00140  Steroid hormone biosynthesis
mna00830  Retinol metabolism
mna00860  Porphyrin and chlorophyll metabolism
mna00980  Metabolism of xenobiotics by cytochrome P450
mna00982  Drug metabolism - cytochrome P450
mna00983  Drug metabolism - other enzymes
mna01100  Metabolic pathways
mna01240  Biosynthesis of cofactors
mna04976  Bile secretion
mna05204  Chemical carcinogenesis
Module
mna_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    107541929
   00053 Ascorbate and aldarate metabolism
    107541929
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    107541929
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    107541929
   00860 Porphyrin and chlorophyll metabolism
    107541929
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    107541929
   00982 Drug metabolism - cytochrome P450
    107541929
   00983 Drug metabolism - other enzymes
    107541929
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    107541929
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    107541929
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mna01003]
    107541929
Enzymes [BR:mna01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     107541929
Glycosyltransferases [BR:mna01003]
 Others
  Hydrophobic molecule
   107541929
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4 Pro_3_hydrox_C
Other DBs
NCBI-GeneID: 107541929
NCBI-ProteinID: XP_016074597
LinkDB
Position
Unknown
AA seq 694 aa
MLEKIILVLSLQISLLGITLGGNVLIWPMEGSHWLNIKIIIDELIKKQHNVTVIVYSGAL
FIDPTYNPSLTFEIYKVPFGKERMEEMIRNFILTWMGNRPSPSTIWRFYQEIGIVLQDFH
ALCREICDGVLKNQKLMEKLKKSKFEVLVSDPVFPCGDIVALKLGIPFMFSLRFSPASTV
EKHCGKTPYPPSYVPAILSELNDQMSFTDRIRNFISYHLQDYIFHTLWKSWDSYYSEALD
GSHWLNIKIILEELTQRNHNVTVLASSATLFINSNPDSLVNFEVIPVSFKKSNIDSLIEH
MIMLWIDHRPTPLTLWTFYKELGKLLDTFFQINLQICDGVLNNPKLMSRLQKGGFDVLVA
DPVTICGDLVALKLGIPFMYTLRFSPASTVERHCGKIPTPASYVPAALSELTDQMTFAER
VKNIISYPLQDYIFQSYWGEWNLYYSKVLGRPTTLCETMGKAEIWLMRTYWDFEFPRPYL
PNFEFVGGLHCKPAKPLPKVLWRYKGKKPATLGANTRLYDWIPQNDLLGHPKAKAFITHG
GTNGIYEGIYHGVPMVGVPMFADQHDNIAHMKAKGAAVEVNINTMTSADLHDALKTVINE
PSYKENAMRLSRIHHDQPIKPLDRAVFWIEFVMRHKGAKHLRPAAHNLTWFQYHSLDVIG
FLLACAASAIILVTNCCLFSCRKFGKTGKKKKRE
NT seq 2085 nt   +upstreamnt  +downstreamnt
atgttagaaaagatcattctggtgttgtctcttcagataagtctcctaggaatcactctt
ggtgggaatgttctgatttggccgatggaaggtagtcattggctaaatattaagatcatt
atagatgagctcattaaaaagcagcataatgtgactgtcattgtttactctggtgcactt
ttcattgatcccacctataacccatctctgacatttgaaatatataaggtgccctttggg
aaagaaagaatggaagaaatgatcagaaattttattttgacatggatgggaaatagacca
tctccttcaaccatttggagattctatcaggagattggcatagtcctccaggacttccat
gcactgtgtagagaaatctgtgatggtgttctcaaaaaccaaaagctgatggaaaagttg
aagaaaagcaaatttgaagtcctggtatcagatccagtatttccttgtggcgatatagta
gctttaaaacttggaattccatttatgttctccttgaggttttctccagcatcgacagtg
gaaaagcactgtgggaagacaccataccctccttcctatgttcctgctattttatcagaa
ctaaacgaccagatgtcttttactgacagaataagaaatttcatttcctaccatctacag
gactacatctttcataccctttggaaatcatgggattcctactatagtgaagctttggat
ggtagccattggttaaatattaagatcattctagaagagctgactcaaagaaatcacaat
gtgaccgtactggcttcatcagcaactttattcatcaactccaatcctgattctcttgtg
aattttgaggtgatacctgtttccttcaagaagagcaatatagattccttaattgaacat
atgataatgctgtggatagaccacaggccaactcctctcacactctggactttctacaaa
gaactcggaaaactcctagatactttttttcaaattaacctacaaatctgtgatggcgta
ttaaacaaccccaagttaatgtcaagacttcagaaaggtggttttgatgtgttggtagcc
gacccagtaacaatctgtggggacctggttgctctgaaattaggaattccatttatgtac
acattgaggttctccccagcctcaacagtggagagacactgtgggaaaattcccacacct
gcctcctatgtaccagcagccttgtccgagctcactgaccagatgacctttgctgaaagg
gttaaaaatatcatatcttatcctctgcaagactatatatttcagtcctactggggagaa
tggaatttgtactacagcaaagttttaggaagacccactacattatgtgagactatgggg
aaagcagaaatttggctaatgaggacatattgggattttgaatttcctcgcccataccta
cctaattttgagtttgtaggaggattgcactgtaaaccagccaaaccgttacctaaggtt
ttgtggagatacaaaggaaagaaaccggccacattgggagccaatactcggctctatgac
tggataccccagaatgaccttctcggtcatcccaaagcaaaagcttttatcactcatggt
ggaacaaatggaatctatgaaggtatttatcatggggtccctatggtgggagttcccatg
tttgctgatcagcatgataacattgctcacatgaaggccaaaggagcagctgtggaggtg
aacataaacacaatgacaagtgcagatttgcatgatgccttgaaaacagtcattaatgaa
ccttcttataaagagaatgctatgaggctatcaaggattcaccatgatcaacctataaag
cccttggatcgagcagtcttctggatcgagtttgtcatgcgccacaaaggagctaaacac
ctgcggccagctgctcacaacctcacctggttccagtaccactctttggatgtgattggg
ttcctgctggcctgtgcagcatctgctataattttggtcacaaattgttgtctgttttct
tgtcgaaaatttggtaaaacaggaaagaagaaaaagagggaatag

KEGG   Miniopterus natalensis: 107541931
Entry
107541931         CDS       T05883                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2A3-like
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
mna  Miniopterus natalensis
Pathway
mna00040  Pentose and glucuronate interconversions
mna00053  Ascorbate and aldarate metabolism
mna00140  Steroid hormone biosynthesis
mna00830  Retinol metabolism
mna00860  Porphyrin and chlorophyll metabolism
mna00980  Metabolism of xenobiotics by cytochrome P450
mna00982  Drug metabolism - cytochrome P450
mna00983  Drug metabolism - other enzymes
mna01100  Metabolic pathways
mna01240  Biosynthesis of cofactors
mna04976  Bile secretion
mna05204  Chemical carcinogenesis
Module
mna_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    107541931
   00053 Ascorbate and aldarate metabolism
    107541931
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    107541931
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    107541931
   00860 Porphyrin and chlorophyll metabolism
    107541931
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    107541931
   00982 Drug metabolism - cytochrome P450
    107541931
   00983 Drug metabolism - other enzymes
    107541931
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    107541931
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    107541931
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mna01003]
    107541931
Enzymes [BR:mna01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     107541931
Glycosyltransferases [BR:mna01003]
 Others
  Hydrophobic molecule
   107541931
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4 Glyco_trans_4_2 Glyco_trans_4_4 Glyco_transf_5 Pro_3_hydrox_C
Other DBs
NCBI-GeneID: 107541931
NCBI-ProteinID: XP_016074602
LinkDB
Position
Unknown
AA seq 530 aa
MLPQKWASVVLLLQLCSAGCGFCGKVLVWPVDMSHWLNIKNILEELAKKGHEVTVLTPAH
TKLIDYKKPSPLNFEILHSEYQKESVEKAHEKFLDVILNVLPNLTPWQSTIKLNDVFLEI
TESVKTLCESAVYNQALMKKLQERNYDVMVIDPVMPCGELVAELLGVPFVLTLRVSMGGM
KEKHCGKLPAPPSYVPVQMVGLTDRMTFLERVKNVMFSVLFDFRIRDYDIHFWDQFYSEA
LGRPTTLCETLGKAEIWLIRTYWDFEFPRPYLPNFEFVGGLHCKPAKPLPKEIEEFVQSS
GKDGIVVFSLGSVIQNLTEEKGNLIASALAQIPQKVLWRYKGKKPATLGANTRLYDWLPQ
NDLLGHPKTKAFITHGGINGIYEAIYHGVPMVGVPMFADQPDNIAHMKAKGAAVEVNLYT
MTSADLLHALRTVINNSSYKENAMKLSRIHHDQPMRPLDRAVFWIEFVMRHKGAKHLRPA
SHDLTWFQYHSLDVIGFLLACAASAIFLITKCCLFSCQKFGKTGKKKKRE
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgttacctcagaagtgggcttcggtggttctgctgctgcagctctgcagtgctggctgt
ggattctgtggaaaggttctggtgtggcctgttgacatgagccactggcttaatataaag
aacattctagaggaactcgcaaagaaaggacatgaggtaactgtgttgactcctgcacat
actaagctcattgactacaagaaaccttccccactgaacttcgaaatattgcattcagaa
tatcagaaagaatcagtggagaaagcacatgagaaatttctggacgtaattttgaatgtc
ttgccaaacttaacaccctggcaatcaacaataaaactgaatgatgtttttcttgaaata
actgaaagtgtaaaaaccctgtgtgagagtgcagtctacaatcaggcactcatgaagaag
ctccaggaaagaaactacgatgtaatggttatagaccctgtaatgccctgtggagagttg
gtggcggaattgcttggagtcccttttgtgctcacattaagagtgtctatgggaggcatg
aaggagaaacactgtgggaaacttccagctccaccttcttatgttcctgttcagatggtg
ggacttacagaccgaatgacctttctggaaagagtaaaaaatgtaatgttctctgttctc
tttgacttccggatccgggattatgacattcatttttgggaccaattttacagtgaggca
ttaggaagacccactacattatgtgagactctggggaaagctgaaatttggttaattagg
acatattgggattttgaatttcctcgcccatacctacctaattttgaatttgttggagga
ttgcactgcaaacctgccaaacctttacctaaggaaatagaagaatttgtccagagctca
ggcaaagatggtattgtggtgttttctctgggttcagtgatccaaaatctcacagaagaa
aagggcaatcttattgcctcggcccttgcccagattccacagaaggttttatggagatac
aaaggaaagaaaccagccacattaggagccaatactcggctctatgattggctaccccag
aatgatcttcttggtcatccaaaaaccaaagcttttatcactcatggtggaataaatggg
atctatgaagctatttatcatggggtccctatggtgggagttcccatgtttgctgatcag
cctgataacattgctcacatgaaggccaaaggagcggctgtggaggtgaacttatacaca
atgacaagtgcagatttgctgcacgccttgagaacagtcattaacaattcttcctataaa
gagaatgctatgaagttgtcaaggattcaccatgaccagcccatgagacctctagatcga
gcagtcttctggatcgagtttgtcatgcgccacaaaggagccaaacacctgcggccagcc
tcccatgacctcacctggttccagtaccactctttggatgtgattgggttcctgctggcc
tgtgcagcatctgctatattcttgatcacaaaatgttgtttattttcttgtcaaaaattt
ggtaaaacaggaaagaagaaaaagagggaatag

KEGG   Miniopterus natalensis: 107545721
Entry
107545721         CDS       T05883                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2B4-like isoform X1
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
mna  Miniopterus natalensis
Pathway
mna00040  Pentose and glucuronate interconversions
mna00053  Ascorbate and aldarate metabolism
mna00140  Steroid hormone biosynthesis
mna00830  Retinol metabolism
mna00860  Porphyrin and chlorophyll metabolism
mna00980  Metabolism of xenobiotics by cytochrome P450
mna00982  Drug metabolism - cytochrome P450
mna00983  Drug metabolism - other enzymes
mna01100  Metabolic pathways
mna01240  Biosynthesis of cofactors
mna04976  Bile secretion
mna05204  Chemical carcinogenesis
Module
mna_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    107545721
   00053 Ascorbate and aldarate metabolism
    107545721
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    107545721
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    107545721
   00860 Porphyrin and chlorophyll metabolism
    107545721
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    107545721
   00982 Drug metabolism - cytochrome P450
    107545721
   00983 Drug metabolism - other enzymes
    107545721
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    107545721
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    107545721
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mna01003]
    107545721
Enzymes [BR:mna01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     107545721
Glycosyltransferases [BR:mna01003]
 Others
  Hydrophobic molecule
   107545721
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4
Other DBs
NCBI-GeneID: 107545721
NCBI-ProteinID: XP_016079386
LinkDB
Position
Unknown
AA seq 445 aa
MAMKWIFILLLLQLSCHVRPGWCGKVLVWPTEYSHWMNMKTILDELVQRGHEVTVLTSSA
SILVDPNKPSAINFEIYPTSLTKDDFEHIFMQVLSKWIYIPDDTFFSYFSQMQDMLWELY
ISFRKLCKDVALNKKLMTKLQETRFDVILADPFGPCGRPTTLFELMSKAEMWLIRTYWDF
EFPRPFLPHFVFVGGLHCKPAKPLPKEMEEFAQSSGQNGIVVFTLGSMVSNISEERANVI
ASALAQIPQKVLWRFNGKKPDTLGPNTRLYKWIPQNDLLGHPKTKAFITHGGTNGIYEAI
YHGVPMVGIPMFADQPDNIARMQTKGAAVRLDFNTMSSADLLNALKTVINDPSYKENAMR
LSRIQHDQPMKPLDRAVFWIEFVMRHKGAKHLRPASHDLTWFQYHSLDVIGFLLACVATA
IFVITKCVLFCCQKCANPGKKGKRE
NT seq 1338 nt   +upstreamnt  +downstreamnt
atggctatgaaatggattttcattctgctgctcctacagctgagttgtcacgttcgccct
gggtggtgtggaaaggtgctggtatggcccacagaatatagtcattggatgaatatgaaa
acaatcctggatgaacttgtccaaagaggccatgaagtgactgttctgacatcttcagct
tcaattcttgttgatccaaataagccatctgctattaattttgagatttatcctacatct
ttaacaaaagatgattttgaacatattttcatgcaagtactctccaaatggatatatata
ccagatgatacatttttttcttatttttcacaaatgcaagatatgttgtgggaactttat
atttcttttcgtaagctctgtaaagatgtagctttgaacaagaaacttatgacaaaacta
caggaaacaaggtttgatgtcattcttgcagacccctttggaccctgtggaagacccact
acattatttgaattaatgagtaaagctgaaatgtggctcattcggacctactgggatttt
gaattccctcgcccattcttaccacatttcgtttttgttggaggcctccactgcaaacct
gccaaacccctgcctaaggaaatggaagagtttgcccagagctctggacaaaatggtatt
gttgtgtttactctggggtcaatggtcagtaacatatcagaagaaagagccaatgtgatt
gcctcagcccttgcccagattccacaaaaggttctgtggaggtttaatggcaagaaacca
gacaccttaggaccaaatactcggctctataagtggattccccagaatgaccttcttggt
catccaaaaaccaaagccttcataactcacggtggaaccaatggcatctatgaggcgatc
taccatggggtccctatggtgggcatccctatgtttgctgatcaacctgataacattgct
cgcatgcagaccaagggagcagctgtcagactggacttcaacacaatgtctagtgcagac
ctgctcaacgcactgaagacagtcattaatgacccttcatataaagagaatgcaatgagg
ttatcaagaattcaacatgaccagcccatgaaacctctggatcgagcagtcttctggatc
gagtttgtcatgcgccacaaaggagccaaacacctgcggccagcctcccatgacctcacc
tggttccagtaccactctttggatgtgattgggttcctgctggcctgtgtggcaactgcc
atatttgtcatcacaaaatgtgttctgttttgttgccagaagtgtgctaacccaggaaag
aaggggaaaagggagtag

KEGG   Miniopterus natalensis: 107545856
Entry
107545856         CDS       T05883                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2B31-like
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
mna  Miniopterus natalensis
Pathway
mna00040  Pentose and glucuronate interconversions
mna00053  Ascorbate and aldarate metabolism
mna00140  Steroid hormone biosynthesis
mna00830  Retinol metabolism
mna00860  Porphyrin and chlorophyll metabolism
mna00980  Metabolism of xenobiotics by cytochrome P450
mna00982  Drug metabolism - cytochrome P450
mna00983  Drug metabolism - other enzymes
mna01100  Metabolic pathways
mna01240  Biosynthesis of cofactors
mna04976  Bile secretion
mna05204  Chemical carcinogenesis
Module
mna_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    107545856
   00053 Ascorbate and aldarate metabolism
    107545856
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    107545856
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    107545856
   00860 Porphyrin and chlorophyll metabolism
    107545856
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    107545856
   00982 Drug metabolism - cytochrome P450
    107545856
   00983 Drug metabolism - other enzymes
    107545856
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    107545856
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    107545856
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mna01003]
    107545856
Enzymes [BR:mna01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     107545856
Glycosyltransferases [BR:mna01003]
 Others
  Hydrophobic molecule
   107545856
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4
Other DBs
NCBI-GeneID: 107545856
NCBI-ProteinID: XP_016079600
LinkDB
Position
Unknown
AA seq 436 aa
MPTKWISVLLLLQLSCHIRPGWCGKVLVWPTEYSHWMNMKTILDELVHRGHEVTVLTSSA
SILVDPNKASAIKFEIFPASLTKDDFEDVIMQLISKWTYMPKDTFWTYFSLTQDMILEYS
DYIRKLCKDAVLNKKLMTKLQESRFDVVLADAVGPCGELLAELLKRPLVYSLRAFPGYKI
EKYTGGLPFPPSYVPVVLSELSDQMTFMERVKNMIYVLYFDFWFQAFREKWDQFYSEVLG
RPTTLFELMSKAEIWFIRSYWDFEFPRPLLPHFEFVGGLHCKPAKPLPKEMEEFAQSSGE
NGIVVFTLGSMVTNMTEESANMIASALAQIPQKVIWRYDGKKPDTLGPNTRLYKWIPQND
LLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPMFADQPDNIARMQTKGAAVRLDVNTIS
STGLLNALKTVINDPS
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgcctacgaagtggatttccgttctgctgctgctacagctgagctgtcacattcgccct
gggtggtgtggaaaggtgctggtgtggcccacagaatatagccattggatgaatatgaag
acaatcctggatgaacttgtccacagaggccatgaagtgactgttctgacatcttcagct
tcaattcttgttgatcccaataaggcatctgccattaagtttgaaatttttcctgcatct
ttaacaaaagatgattttgaggatgttatcatgcagctgatctctaaatggacatatatg
ccaaaagatacattttggacttatttttcactaacacaagatatgattttggaatattct
gattatattcgaaagctctgtaaagatgcagttttaaacaagaaacttatgacaaaacta
caggaatcaaggtttgatgtcgttcttgcagacgctgttggaccctgtggtgagctgctg
gctgaactacttaaaagacctttggtgtacagtctccgggcctttcctggttataaaatt
gaaaagtatactggaggacttccattccctccatcctatgtaccagttgtcttgtcagaa
ttaagtgatcaaatgaccttcatggagagggtaaaaaatatgatatacgtgctttatttt
gacttctggttccaagcatttagagagaagtgggatcagttttacagtgaagtactaggg
agacccaccacattatttgagttaatgagtaaagctgaaatatggttcattcgaagctac
tgggattttgagtttcctcgcccgctcttgccacattttgaatttgttggaggcctccac
tgcaaaccggccaaacctttgcctaaggaaatggaagagtttgcccagagctctggagaa
aatggtattgtcgtgtttactctggggtcaatggtcactaacatgacggaagaaagtgcg
aatatgattgcatcagcccttgcccagattcctcaaaaggttatatggagatacgatggc
aaaaagccagacaccttagggccaaatactcggctctataagtggatcccccagaatgac
cttcttggtcatccaaaaaccaaagcctttataactcatggtggaaccaatggcatctat
gaggcgatctaccatgggatccctatggtgggcatccctatgtttgctgatcaacctgat
aacattgctcgcatgcagaccaagggagcggctgtcagattggacgtgaacactatttca
agtacaggtctgctcaatgcattgaagacagtcatcaatgacccttcgtaa

DBGET integrated database retrieval system