KEGG   Miniopterus natalensis: 107526793
Entry
107526793         CDS       T05883                                 

Gene name
RPS6KA3
Definition
(RefSeq) ribosomal protein S6 kinase alpha-3
  KO
K04373  ribosomal protein S6 kinase alpha-1/2/3/6 [EC:2.7.11.1]
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04114  Oocyte meiosis
mna04150  mTOR signaling pathway
mna04714  Thermogenesis
mna04720  Long-term potentiation
mna04722  Neurotrophin signaling pathway
mna04914  Progesterone-mediated oocyte maturation
mna04931  Insulin resistance
mna05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107526793 (RPS6KA3)
   04150 mTOR signaling pathway
    107526793 (RPS6KA3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107526793 (RPS6KA3)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107526793 (RPS6KA3)
  09156 Nervous system
   04720 Long-term potentiation
    107526793 (RPS6KA3)
   04722 Neurotrophin signaling pathway
    107526793 (RPS6KA3)
  09159 Environmental adaptation
   04714 Thermogenesis
    107526793 (RPS6KA3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    107526793 (RPS6KA3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107526793 (RPS6KA3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107526793 (RPS6KA3)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mna03019]
    107526793 (RPS6KA3)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107526793 (RPS6KA3)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   107526793 (RPS6KA3)
Messenger RNA biogenesis [BR:mna03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     107526793 (RPS6KA3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo Pkinase_fungal Pkinase_C APH YrbL-PhoP_reg tRNA-synt_1f
Other DBs
NCBI-GeneID: 107526793
NCBI-ProteinID: XP_016054858
LinkDB
Position
Unknown
AA seq 712 aa
MDEPMGEEEINPQTEEGNIKEIAITHHVKEGHEKADPSQFELLKVLGQGSFGKVFLVKKI
SGSDARQLYAMKVLKKATLKVRDRVRTKMERDILVEVNHPFIVKLHYAFQTEGKLYLILD
FLRGGDLFTRLSKEVMFTEEDVKFYLAELALALDHLHSLGIIYRDLKPENILLDEEGHIK
LTDFGLSKESIDHEKKAYSFCGTVEYMAPEVVNRRGHTQSADWWSFGVLMFEMLTGTLPF
QGKDRKETMTMILKAKLGMPQFLSPEAQSLLRMLFKRNPANRLGAGPDGVEEIKRHLFFS
TIDWNKLYRREIHPPFKPATGRPEDTFYFDPEFTAKTPKDSPGIPPSANAHQLFRGFSFV
AITSDDESQAMQTVGVHSIVQQLHRNSIQFTDGYEVKEDIGVGSYSVCKRCIHKATNMEF
AVKIIDKSKRDPTEEIEILLRYGQHPNIITLKDVYDDGKYVYVVTELMKGGELLDKILRQ
KFFSEREASAVLFTITKTVEYLHAQGVVHRDLKPSNILYVDESGNPESIRICDFGFAKQL
RAENGLLMTPCYTANFVAPEVLKRQGYDAACDIWSLGVLLYTMLTGYTPFANGPDDTPEE
ILARIGSGKFSLSGGYWNSVSDTAKDLVSKMLHVDPHQRLTAALVLRHPWIVHWDQLPQY
QLNRQDAPHLVKGAMAATYSALNRNQSPVLEPVGRSTLAQRRGIKKITSTAL
NT seq 2139 nt   +upstreamnt  +downstreamnt
atggatgaacctatgggagaggaggagattaatccacaaactgaagaaggcaatatcaaa
gaaattgcaatcacacatcatgtaaaggaaggacatgaaaaggcagatccttcccaattt
gaacttttaaaagtattagggcagggatcatttggaaaggttttcttagtcaagaaaatc
tcaggctccgatgctagacagctttatgccatgaaagtactgaagaaggccacattgaaa
gttcgagaccgtgttcgtacaaaaatggagcgtgatatcttggtagaagttaatcatccg
tttattgtcaagttgcattatgcttttcaaactgaagggaagttgtatcttattttggat
tttctcaggggaggagatttgtttacacgcttatccaaagaggtgatgttcacagaagaa
gatgtcaaattctacttggctgaacttgcacttgctttagaccatctgcatagcctggga
ataatctatagagacttaaaaccagaaaacatacttcttgatgaagaaggtcacatcaaa
ttaacagattttggcctaagtaaagagtctattgaccatgaaaagaaggcgtattctttt
tgtggaactgtggaatatatggctccagaagtagttaatcgtcgaggtcatactcagagt
gcggactggtggtcttttggtgtgttaatgtttgagatgctcactggtacactacctttc
caaggaaaagatcgaaaagaaacaatgactatgatccttaaagctaaacttgggatgcca
cagtttttgagtcctgaagcccagagtcttttacgaatgcttttcaaacgaaatcctgca
aacagattaggcgcaggaccagatggagttgaagaaattaaaagacatttatttttctca
acaatagattggaataaactatacagaagagaaattcatccaccttttaaacctgcaact
ggcaggcctgaagatacattctattttgatcctgagttcactgcaaaaactcccaaagat
tcacctggcattccacctagtgctaatgcacatcagctttttcgggggtttagttttgtt
gctattacctcagatgatgaaagccaagccatgcagacagttggtgtgcattcaattgtt
cagcagttgcacaggaacagtattcagtttactgatggatatgaagtaaaagaagatatt
ggagttggctcctactcagtttgcaagagatgtatacataaagccacaaacatggagttt
gcagtgaagattattgataaaagcaagagagacccaacagaagaaattgaaattcttctt
cgttatggacagcatccaaacattattactctaaaggatgtatacgatgatggaaaatat
gtgtatgtagtgacagaacttatgaaagggggtgaattgctggataaaatacttagacag
aaatttttctctgaacgagaggccagcgctgtcctgtttactataaccaaaactgttgaa
tatcttcacgctcaaggggtggttcacagagacttgaaacctagcaacattctttatgtg
gatgaatctggcaatccagaatcgattcgaatttgtgattttggctttgccaagcagcta
agagcagaaaatggtcttctcatgacaccttgttatactgcaaattttgttgcaccagag
gttttgaaacgacaaggctatgatgctgcttgtgatatatggagtcttggtgtcctcctc
tatacaatgcttactggttacactccatttgcaaatggccctgatgatacaccagaggaa
atattggcacgcatcggcagcggaaaattctcactcagtggtggttattggaattctgtt
tccgacacagcaaaggacctggtgtcaaagatgcttcatgtggaccctcatcagagattg
actgctgcccttgtgctcagacacccttggatagtccactgggaccaactgccacaatac
cagctaaacagacaggacgcaccacatctggtcaagggtgccatggcagctacatattct
gctttaaaccgtaatcagtcaccagttttggaaccagtaggccgctctactcttgctcag
cgtagaggtattaaaaaaatcacctccacagccctgtga

KEGG   Miniopterus natalensis: 107530622
Entry
107530622         CDS       T05883                                 

Gene name
RPS6KA6
Definition
(RefSeq) ribosomal protein S6 kinase alpha-6
  KO
K04373  ribosomal protein S6 kinase alpha-1/2/3/6 [EC:2.7.11.1]
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04114  Oocyte meiosis
mna04150  mTOR signaling pathway
mna04714  Thermogenesis
mna04720  Long-term potentiation
mna04722  Neurotrophin signaling pathway
mna04914  Progesterone-mediated oocyte maturation
mna04931  Insulin resistance
mna05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107530622 (RPS6KA6)
   04150 mTOR signaling pathway
    107530622 (RPS6KA6)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107530622 (RPS6KA6)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107530622 (RPS6KA6)
  09156 Nervous system
   04720 Long-term potentiation
    107530622 (RPS6KA6)
   04722 Neurotrophin signaling pathway
    107530622 (RPS6KA6)
  09159 Environmental adaptation
   04714 Thermogenesis
    107530622 (RPS6KA6)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    107530622 (RPS6KA6)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107530622 (RPS6KA6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107530622 (RPS6KA6)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mna03019]
    107530622 (RPS6KA6)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107530622 (RPS6KA6)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   107530622 (RPS6KA6)
Messenger RNA biogenesis [BR:mna03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     107530622 (RPS6KA6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo Pkinase_fungal Pkinase_C APH YrbL-PhoP_reg
Other DBs
NCBI-GeneID: 107530622
NCBI-ProteinID: XP_016059980
LinkDB
Position
Unknown
AA seq 744 aa
MLPFVPQEEPWDQDMEVFSGGASSCEVNHLKMDDEPMEEGEADSCQDEGVVKEIPITHHV
KEGYEKADPAQFELLKVLGQGSFGKVFLVRKKTGPDAGQLYAMKVLKKASLKVRDRVRTK
MERDILVEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDVFTRLSKEVLFTEEDVKFYLAE
LALALDHLHRLGIVYRDLKPENILLDEIGHIKLTDFGLSKESVDQEKKAYSFCGTVEYMA
PEVVNRRGHSQSADWWSYGVLMFEMLTGTLPFQGKDRNETMNMILKAKLGMPQFLSAEAQ
SLLRMLFKRNPANRLGSEGVEEIKRHNFFANIDWNKLYKREIQPPFKPASGKPDDTFCFD
PEFTAKTPKDSPGLPASANAHQLFKGFSFVSTSIAEEYKITPITSANVLSIIQINGNTAQ
FGEVYELKEDIGVGSYSVCKRCIHRVTNMEFAVKIIDKNKRDPSEEIEILMRYGQHPNII
TLKDVYDDGRYVYLVTDLMKGGELLDRILKQKCFSEREASDVLFVITKTVDYLHCQGVVH
RDLKPSNILYMDESANADSIRICDFGFAKQLRGENGLLLTPCYTANFVAPEVLMQQGYDA
ACDIWSLGVLFYTMLAGYTPFANGPNDTPEEILLRIGNGKFSLSGGNWDNISDGAKDLLS
HMLHMDPHQRYTTEQVLKHSWIIHRDQLPNDQPNSNDTSYVVKGAVVATYSALTHKTFQP
VLEPVAASSLAQRRSMKKRTSTGL
NT seq 2235 nt   +upstreamnt  +downstreamnt
atgctaccattcgttcctcaggaggagccctgggaccaagacatggaggtgttcagtggc
ggagcgagcagctgcgaggtaaatcatcttaaaatggatgatgagccaatggaagaagga
gaagcagattcttgccaagatgaaggagttgttaaagaaattcctattactcaccacgtt
aaggaaggatatgagaaagcagaccctgcacagtttgagttgctcaaggttcttggtcag
ggatcctttggaaaggtatttcttgttagaaagaagactggccctgatgctgggcaactc
tatgcaatgaaggtgttaaaaaaagcctctttaaaagttcgagacagagttcggacaaag
atggagagggatatactggtggaagtaaatcatccatttattgtcaaattgcattatgcc
tttcagactgaagggaaactttatttaatactggattttctcagaggaggagatgtcttc
acaagattatccaaagaggttttgtttacagaggaagatgtgaaattctaccttgcagaa
ttagcccttgctttggatcatctgcaccgattaggaattgtgtatagagacctgaagcca
gaaaacattttgcttgatgaaataggacatatcaagttaacagattttggactcagcaaa
gaatcagtagatcaagaaaagaaagcctactcattttgtggtacagtggagtatatggct
cctgaagtagtaaataggagaggtcattcccagagtgctgattggtggtcatatggcgta
cttatgtttgaaatgcttactggtacactgccatttcaaggtaaagacagaaatgagacc
atgaatatgatattaaaagcaaaacttggaatgcctcagtttcttagtgctgaagcacaa
agtcttctaaggatgttatttaaaaggaatccagcaaatagattgggttcagaaggagtt
gaggaaatcaaaagacataatttctttgcaaatattgactggaataaattatataaaaga
gaaattcaacctcctttcaaacctgcttctggaaaaccagatgatactttttgttttgat
cctgaatttactgcaaaaacacctaaagattctcctggtttgccagccagtgctaatgct
catcaactcttcaaaggattcagctttgtttcaacttctattgcagaagaatataaaatc
actcctatcacaagtgcaaatgtattatcaattattcagataaatggaaatactgcacaa
tttggtgaagtatatgaattaaaagaagatattggtgttggctcctactctgtttgcaag
cgatgcatacatagagttacaaatatggaatttgcagtgaagatcattgacaaaaataag
agagatccttcagaagaaattgaaattttgatgcgctatgggcaacatcccaacattatc
actttaaaggatgtttatgatgatggtagatatgtttatcttgttacggatttgatgaaa
ggaggagaactacttgaccgtattctcaaacaaaaatgtttctcagaacgggaagctagt
gatgtactgtttgtaataactaagacagttgactatcttcattgtcaaggagttgttcat
cgtgatcttaaacctagtaatattttatatatggatgaatcagccaatgcagactccatt
aggatctgtgattttgggtttgcaaagcaacttcgaggagaaaatgggcttctcttaact
ccatgctacactgcaaactttgtagcacctgaggttcttatgcaacagggctatgatgct
gcttgtgatatttggagtctgggagtccttttttacacaatgttggctggctacactcca
tttgctaatggccctaatgatactcctgaagagatactgctacgtataggcaatggaaag
ttctctttgagtggtggaaactgggacaatatttcagatggagcaaaggatttgctatcc
catatgctacatatggacccacatcagcgatacactacagaacaagtattaaaacactca
tggataatccacagagaccagttaccaaatgatcagccaaatagtaatgatacatcatat
gttgttaagggagcagtggttgccacatattcagccctcactcacaagaccttccaacca
gtcctagagcctgttgctgcctcaagtttagctcagcgacggagcatgaaaaagcggaca
tcaactggcttgtaa

KEGG   Miniopterus natalensis: 107532955
Entry
107532955         CDS       T05883                                 

Gene name
RPS6KA2
Definition
(RefSeq) ribosomal protein S6 kinase alpha-2
  KO
K04373  ribosomal protein S6 kinase alpha-1/2/3/6 [EC:2.7.11.1]
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04114  Oocyte meiosis
mna04150  mTOR signaling pathway
mna04714  Thermogenesis
mna04720  Long-term potentiation
mna04722  Neurotrophin signaling pathway
mna04914  Progesterone-mediated oocyte maturation
mna04931  Insulin resistance
mna05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107532955 (RPS6KA2)
   04150 mTOR signaling pathway
    107532955 (RPS6KA2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107532955 (RPS6KA2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107532955 (RPS6KA2)
  09156 Nervous system
   04720 Long-term potentiation
    107532955 (RPS6KA2)
   04722 Neurotrophin signaling pathway
    107532955 (RPS6KA2)
  09159 Environmental adaptation
   04714 Thermogenesis
    107532955 (RPS6KA2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    107532955 (RPS6KA2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107532955 (RPS6KA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107532955 (RPS6KA2)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mna03019]
    107532955 (RPS6KA2)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107532955 (RPS6KA2)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   107532955 (RPS6KA2)
Messenger RNA biogenesis [BR:mna03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     107532955 (RPS6KA2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo Pkinase_fungal Pkinase_C APH YrbL-PhoP_reg
Other DBs
NCBI-GeneID: 107532955
NCBI-ProteinID: XP_016062985
LinkDB
Position
Unknown
AA seq 644 aa
MKVLKKATLKVRDRVRSKMERDILAEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDLFSR
LSKEVMFTEEDVKFYLAELALALDHLHGLGIIYRDLKPENILLDEEGHIKITDFGLSKEA
IDHDKRAYSFCGTIEYMAPEVVNRRGHTQSADWWSFGVLMFEMLTGSLPFQGKDRKETMA
LILKAKLGMPQFLSPEAQSLLRALFKRNPVNRLGAGSDGVEEIKRHPFFVTTDWNKLYRR
EIKPPFKPAVGRPEDTFHFDPEFTARTPTDSPGVPPSANAHHLFRGFSFVASNLVQEPLQ
QDLHKAAVHPIVQQLHGNNIHFTDGYEIKEDIGVGSYSVCKRCVHRATDAEYAVKIIDKS
RRDPSEEIEILLRYGQHPNIITLKDVYDDGKFVYLVTELMRGGELLDRILRQRYFSEREA
SDVLCTIAKTMDYLHSQGVVHRDLKPSNILYMDESGNPESIRICDFGFAKQLRAENGLLM
TPCYTANFVAPEVLKRQGYDAACDVWSLGILLYTMLAGFTPFANGPDDTPEEILARIGSG
KYALSGGNWDSVSEAAKDVVSKMLHVDPHQRLTAVQVLKHPWIVNREYLSQNQLSRQDVH
LVKGAMAATYLALNRTPQAPRLEPVLASGLAQRRGMKRLTSTRL
NT seq 1935 nt   +upstreamnt  +downstreamnt
atgaaggtcctgaagaaggccaccctgaaagttcgcgaccgagtcaggtcgaagatggag
agagatatcttggcagaagtgaatcaccccttcattgtgaagctccattatgcctttcag
acggaagggaagctctacctgatcctggacttcctgcggggcggggacctcttctcccgg
ctctccaaagaggtcatgttcacggaggaggacgtcaagttctacctggccgagctggcc
ctggctctagaccacctgcacggcctggggatcatctacagagacctgaagcccgagaac
atcctcctggacgaagagggccacattaagatcacagatttcgggctgagtaaggaggcc
atcgaccacgacaagcgagcctactccttctgcgggaccatcgagtacatggcgcccgag
gtggtgaaccggcggggacacacgcagagcgccgactggtggtccttcggcgtgctcatg
ttcgagatgctcacggggtccctgccgttccaggggaaggacaggaaggagaccatggcc
ctcatcctcaaggccaagctggggatgccgcagttcctcagccccgaggcgcagagcctg
ctgagagccctcttcaagcggaacccggtcaaccggctgggtgccggcagcgatggcgtg
gaggagatcaaacgccaccctttcttcgtcaccacagactggaacaagctgtaccgaagg
gaaatcaagccacccttcaagcccgcggtgggccggcccgaggacaccttccacttcgac
cccgagttcacggcccggacgcccacagactcgccgggcgtcccccccagcgccaacgct
caccatctgttcagaggcttcagtttcgtggcctccaacctggtgcaggagcccttgcag
caggacctgcacaaagccgccgttcaccccatcgtgcagcagctgcacgggaacaacatc
cacttcaccgacggctatgagatcaaggaggacatcggggtgggctcctactccgtgtgc
aagcggtgtgtacacagagccaccgacgcggagtacgccgtgaagatcatcgacaagagc
aggcgagacccctcggaggagatcgagatcctgctgcggtatggccagcaccccaacatc
atcaccctcaaggacgtctacgacgacgggaagttcgtgtacctggtgacggagctgatg
cggggcggcgagctcctggaccgcatcctgcggcagaggtacttctcggagcgggaggcc
agcgacgtgctgtgcaccatcgccaagaccatggactacctgcactcccagggggtggtg
caccgcgacctgaagccgagcaacatactgtacatggacgagtccgggaaccccgagtcc
atccggatctgcgacttcgggttcgccaagcagctgcgtgcggagaacggactgctgatg
acgccctgctacacggccaacttcgtggcgccggaggtgctgaagcggcagggctacgac
gcagcctgcgacgtctggagcctggggatcctgctctacaccatgctggcgggattcacc
ccctttgcaaacgggccagacgatactcccgaggagatcctggcgcggatcggcagtggg
aagtacgccctctcgggcgggaactgggactccgtctccgaggcggccaaggacgtggta
tccaagatgctccacgtggacccgcaccagcgcctgactgctgttcaggtcctgaaacac
ccgtggattgtgaacagagagtacctgtcccagaatcagctcagcagacaggatgtccac
ctggtgaagggcgcgatggccgccacctacttggctctgaaccggacgccgcaggccccg
cggctggagccggtgctggcgtcgggcctggcgcagcgcaggggcatgaagagactcacg
tccacgcgcttgtag

KEGG   Miniopterus natalensis: 107539953
Entry
107539953         CDS       T05883                                 

Gene name
RPS6KA1
Definition
(RefSeq) ribosomal protein S6 kinase alpha-1
  KO
K04373  ribosomal protein S6 kinase alpha-1/2/3/6 [EC:2.7.11.1]
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04114  Oocyte meiosis
mna04150  mTOR signaling pathway
mna04714  Thermogenesis
mna04720  Long-term potentiation
mna04722  Neurotrophin signaling pathway
mna04914  Progesterone-mediated oocyte maturation
mna04931  Insulin resistance
mna05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107539953 (RPS6KA1)
   04150 mTOR signaling pathway
    107539953 (RPS6KA1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107539953 (RPS6KA1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107539953 (RPS6KA1)
  09156 Nervous system
   04720 Long-term potentiation
    107539953 (RPS6KA1)
   04722 Neurotrophin signaling pathway
    107539953 (RPS6KA1)
  09159 Environmental adaptation
   04714 Thermogenesis
    107539953 (RPS6KA1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    107539953 (RPS6KA1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107539953 (RPS6KA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107539953 (RPS6KA1)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mna03019]
    107539953 (RPS6KA1)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107539953 (RPS6KA1)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   107539953 (RPS6KA1)
Messenger RNA biogenesis [BR:mna03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     107539953 (RPS6KA1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo Pkinase_fungal Pkinase_C APH YrbL-PhoP_reg
Other DBs
NCBI-GeneID: 107539953
NCBI-ProteinID: XP_016072057
LinkDB
Position
Unknown
AA seq 643 aa
MKVLKKATLKVRDRVRTKMERDILADVNHPFVVKLHYAFQTEGKLYLILDFLRGGDLFTR
LSKEVMFTEEDVKFYLAELALGLDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGLSKEA
IDHEKKAYSFCGTVEYMAPEVVNRQGHTHSADWWSYGVLMFEMLTGSLPFQGKDRKETMT
LILKAKLGMPQFLSTEAQSLLRALFKRNPANRLGSGPDGAEEIKRHVFYSTIDWNKLYRR
EIKPPFKPAVAQPDDTLYFDTEFTSRTPKDSPGIPPSAGAHQLFRGFSFVATGLMEDDGK
TRATQAPLHSVVQQLHGKNLVFSDGYVVKETIGVGSYSVCKRCVHKATNMEYAVKVIDKS
KRDPSEEIEILLRYGQHPNIITLKDVYDDGKHVYLVTELMRGGELLDKILRQKFFSEREA
SFVLHTISKTVEYLHSQGVVHRDLKPSNILYVDESGNPECLRICDFGFAKQLRAENGLLM
TPCYTANFVAPEVLKRQGYDEGCDIWSLGILLYTMLAGYTPFANGPNDTPEEILTRIGSG
KFTLSGGNWNTVSETAKDLVSKMLHVDPHQRLTAKQVLQHPWITQKDKLPQSQLSHQDLQ
LVKGAMAATYSALNSSKPTPQLKPIESSILAQRRVRKLPSTTL
NT seq 1932 nt   +upstreamnt  +downstreamnt
atgaaggtactaaagaaggcaacactgaaagtgcgtgaccgcgttcggaccaagatggag
agagacatcctggctgatgtaaaccacccatttgtggtgaagctgcactatgccttccag
actgagggcaagctctatcttattctggacttcctgcgtggcggggacctcttcacacgg
ctctccaaagaggttatgttcacggaggaggacgtgaagttttacctggctgagctcgcc
ctgggcctggaccacctgcacagcctgggcatcatttacagagacctcaagcctgagaac
atccttctcgatgaggagggccacatcaaactcactgacttcggcttgagcaaggaagcc
attgaccatgagaagaaggcctattccttctgtgggacggtggagtacatggcccctgag
gtcgtcaaccgccagggccacacccacagtgcagattggtggtcctatggggtgttgatg
tttgagatgctgacaggctccctgcccttccaggggaaggaccggaaggagaccatgaca
ctgattctgaaggcgaagctaggcatgccccagtttctgagcacggaagcccagagcctc
ctgcgggccctgttcaagcggaatcctgccaaccggctcggctccggccctgatggggca
gaggaaatcaagcgacatgtcttctactccaccatcgactggaataagctgtaccgtcgt
gaaatcaagccacccttcaagccggccgtggcacaacccgatgacaccttgtactttgac
actgagttcacatcccgtacaccaaaggactccccgggcattccccccagtgctggcgcc
catcagctgttccgtggcttcagcttcgtggctactggcctgatggaggatgacggcaag
acgcgggccacccaggcgccactgcactcagtggtacagcaactgcatgggaagaacctg
gtttttagtgacggctacgtggtgaaggagacaattggtgtgggctcctactccgtgtgc
aagcgctgtgtccacaaggccaccaacatggagtatgctgtcaaggtcattgacaagagc
aagcgggatccctcggaagaaattgagattcttctgcggtatgggcagcaccccaatatc
atcactctaaaagatgtgtatgatgacggcaaacacgtgtacctggtgacagagctgatg
cggggtggggagctgctggacaagatcctacggcagaaattcttctcggagcgggaggcc
agcttcgtcctgcacacaatcagcaaaaccgtggagtatctgcactcccagggggttgta
catagggacctcaaacccagcaatatcctctatgtggacgagtctgggaaccccgagtgc
ctgcgcatctgtgactttggcttcgccaagcagctgcgggctgagaatgggctcctcatg
acaccttgctacactgccaacttcgtggcacctgaggtgctgaagcgccagggctacgat
gaaggctgtgacatctggagcctgggcattctgctgtataccatgctggcgggatacact
ccatttgccaacggacccaatgacacaccagaggaaatcctgacccggataggcagtggg
aagttcaccctcagtggaggaaattggaacacagtttcagagacagccaaggacctggta
tccaagatgctgcacgtggacccccaccagcgcctcacagctaagcaggtcctgcagcac
ccatggattactcagaaagacaagcttcctcagagccagctatcccaccaggacctacaa
ctagtgaagggagccatggcagctacatactctgcactcaacagctccaagcccacccct
cagctgaagcccatcgagtcatctatcctcgcacagcggcgggtgaggaagctgccgtcc
accaccctgtga

DBGET integrated database retrieval system