KEGG   Miniopterus natalensis: 107526812
Entry
107526812         CDS       T05883                                 

Gene name
ABAT
Definition
(RefSeq) 4-aminobutyrate aminotransferase, mitochondrial
  KO
K13524  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
mna  Miniopterus natalensis
Pathway
mna00250  Alanine, aspartate and glutamate metabolism
mna00280  Valine, leucine and isoleucine degradation
mna00410  beta-Alanine metabolism
mna00640  Propanoate metabolism
mna00650  Butanoate metabolism
mna01100  Metabolic pathways
mna04727  GABAergic synapse
Module
mna_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    107526812 (ABAT)
   00650 Butanoate metabolism
    107526812 (ABAT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    107526812 (ABAT)
   00280 Valine, leucine and isoleucine degradation
    107526812 (ABAT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107526812 (ABAT)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107526812 (ABAT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mna01007]
    107526812 (ABAT)
Enzymes [BR:mna01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     107526812 (ABAT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     107526812 (ABAT)
Amino acid related enzymes [BR:mna01007]
 Aminotransferase (transaminase)
  Class III
   107526812 (ABAT)
SSDB
Motif
Pfam: Aminotran_3 Lenti_VIF_2 Tex_N
Other DBs
NCBI-GeneID: 107526812
NCBI-ProteinID: XP_016054873
LinkDB
Position
Unknown
AA seq 500 aa
MASMLLTRRLACSFQHNYRLLVPGSRHISQAAAKVDVEFDYDGPLMKTEVPGPRSRELMK
QLNIIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYSHPALMKLIQQPQ
NASTFINRPALGILPPENFVEKLRESLLSVAPKGMSQLITMACGSCSNENAFKTIFMWYR
NKERGQTGFSKEELETCMVNQAPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPS
FDWPIAPFPRLKYPLEEFVKENQQEEARCLEEVEDLIVKYRKKKRTVAGIIVEPIQSEGG
DNHASDDFFRKLRDISRKHGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPADVMTFSKKMM
TGGFFHKEEFRPNAPYRIFNTWLGDPSKNLLLAEVINVIKREDLLNNAAHAGKALLTGLL
DLQARYPQFISRVRGRGTFCSFDTPDESIRNKLILIARNKGVVLGGCGDKSIRFRPTLVF
RDHHAHLFLNIFSDILADFK
NT seq 1503 nt   +upstreamnt  +downstreamnt
atggcctccatgctgctcacccggcggctggcctgcagcttccagcacaactaccgcctg
cttgtgcccggatccagacatatcagccaggctgcagccaaagttgatgttgaatttgat
tatgacggacctctgatgaagacagaagtcccagggcctagatctcgggagttaatgaaa
cagctgaatataattcagaatgcagaggctgtgcatttcttctgcaattatgaagagagc
cgaggcaactacctggtcgatgtggatggcaaccgaatgttggatctctattcccagatc
tcctctgtccctataggttacagccatccagcgctcatgaaactcatccagcagcctcag
aatgcgagcacgttcatcaacagacctgccttgggaatcctgcctccagagaattttgtg
gagaagctgcgggagtccttgctctcggtggctcctaaaggaatgtcccagctcattacc
atggcctgtggctcctgctccaatgaaaatgccttcaagaccatcttcatgtggtaccgg
aacaaggaaaggggtcaaacgggtttctccaaagaggagctggagacgtgcatggtcaac
caggcccctggctgccccgactacagcatcctctccttcatgggcgccttccacgggagg
accatgggttgcttagcgaccacacattccaaagctattcacaagatcgacatcccttcc
tttgactggcccattgcaccattcccacggctgaaataccctctggaggagtttgtgaag
gagaaccaacaagaagaggcccgctgcctggaagaggtggaggatctgatcgtgaaatat
cggaaaaagaagaggacagtggccgggatcatcgtagagcccatccagtctgagggtgga
gacaaccacgcgtcggatgatttcttccggaagctgagagacatctccaggaagcatggc
tgtgccttcttggtggatgaggtccagacaggagggggctgcactggcaagttctgggcc
catgagcactggggcttggatgaccctgcagacgtgatgaccttcagcaagaagatgatg
actgggggcttcttccacaaggaggagttcaggcccaatgccccataccggatctttaac
acctggctgggggacccgtccaagaacctgctgctggccgaggtcatcaatgtcatcaag
cgggaggacctgctgaataacgcagcccatgctgggaaggccctgctcacggggttgctg
gaccttcaggcccggtacccccagttcatcagcagagtaagaggacgaggcaccttctgc
tccttcgacactccagatgagtccatccggaataaactcattctaatagccagaaacaaa
ggcgtggtgttggggggctgtggtgacaagtccatccgtttccgtcccactctggtcttc
agggatcaccacgcacacctgttcctcaatattttcagcgacatcttagctgacttcaag
taa

DBGET integrated database retrieval system