KEGG   Miniopterus natalensis: 107526843
Entry
107526843         CDS       T05883                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand isoform X1
  KO
K05461  KIT ligand
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04014  Ras signaling pathway
mna04015  Rap1 signaling pathway
mna04072  Phospholipase D signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04640  Hematopoietic cell lineage
mna04916  Melanogenesis
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107526843 (KITLG)
   04014 Ras signaling pathway
    107526843 (KITLG)
   04015 Rap1 signaling pathway
    107526843 (KITLG)
   04072 Phospholipase D signaling pathway
    107526843 (KITLG)
   04151 PI3K-Akt signaling pathway
    107526843 (KITLG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107526843 (KITLG)
  09152 Endocrine system
   04916 Melanogenesis
    107526843 (KITLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107526843 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mna04052]
    107526843 (KITLG)
Cytokines and growth factors [BR:mna04052]
 Growth factors
  Growth factors (RTK binding)
   107526843 (KITLG)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 107526843
NCBI-ProteinID: XP_016054936
LinkDB
Position
Unknown
AA seq 274 aa
MKKTQTWIITCIYLQLLLFNPLVKTTGICTNRVTDDVKDVTKLVANLPKDYRINLKYVPG
MDILPSHCWISEMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECMEGHLF
ENVKKSSKSLVPELFTPEEFFRIFNRSIDAFKNLEMVSSKTSECVVPSTLSPDNDSRVSV
TKPFMLPPVAANSLRNDSSSSNRKALNSIGDSKLQWAAMALPALFSLIIGFGFGALYWKK
KQPNLTRAVENIQINEEDNEISMLQEKEREFQEV
NT seq 825 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattatcacttgcatttatcttcagctgctcctctttaat
cctctcgtcaaaactacagggatctgcacaaaccgtgtaactgatgatgtgaaagacgtt
acaaaattggtggcaaatcttccaaaagactataggataaacctcaagtatgtccccggg
atggacattttgcctagtcattgttggataagcgaaatggtggaacagttgtcagtcagc
ttgacggatcttctggataagttttcaaatatttctgaaggcttgagtaattattctatc
atagacaaacttgtgaaaatagtagacgaccttgtggaatgcatggaaggacacctattt
gagaatgtaaaaaagtcatctaagagcctagtacccgagctgtttactcctgaagaattc
tttagaatttttaatagatccatcgatgccttcaagaacttggagatggtgtcatctaaa
actagtgaatgtgtggttccttcaacattaagtcctgacaatgattccagagtcagtgtc
acaaaaccatttatgttaccccctgttgcagccaactcccttaggaatgacagcagtagc
agtaataggaaggccttgaattccattggagactccaagctgcaatgggcagccatggca
ctgccagcactcttctctcttataattggctttggttttggagccttatactggaagaag
aaacaaccaaatcttacaagggcagttgaaaatatacagattaatgaagaggataatgag
ataagtatgttgcaagaaaaagagagagagtttcaagaagtgtaa

DBGET integrated database retrieval system