KEGG   Miniopterus natalensis: 107526860
Entry
107526860         CDS       T05883                                 

Gene name
MDM2
Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2 isoform X1
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
mna  Miniopterus natalensis
Pathway
mna01522  Endocrine resistance
mna01524  Platinum drug resistance
mna04068  FoxO signaling pathway
mna04110  Cell cycle
mna04115  p53 signaling pathway
mna04120  Ubiquitin mediated proteolysis
mna04144  Endocytosis
mna04151  PI3K-Akt signaling pathway
mna04218  Cellular senescence
mna04625  C-type lectin receptor signaling pathway
mna04919  Thyroid hormone signaling pathway
mna05163  Human cytomegalovirus infection
mna05165  Human papillomavirus infection
mna05169  Epstein-Barr virus infection
mna05200  Pathways in cancer
mna05202  Transcriptional misregulation in cancer
mna05203  Viral carcinogenesis
mna05205  Proteoglycans in cancer
mna05206  MicroRNAs in cancer
mna05214  Glioma
mna05215  Prostate cancer
mna05218  Melanoma
mna05219  Bladder cancer
mna05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107526860 (MDM2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    107526860 (MDM2)
   04151 PI3K-Akt signaling pathway
    107526860 (MDM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107526860 (MDM2)
  09143 Cell growth and death
   04110 Cell cycle
    107526860 (MDM2)
   04115 p53 signaling pathway
    107526860 (MDM2)
   04218 Cellular senescence
    107526860 (MDM2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107526860 (MDM2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    107526860 (MDM2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107526860 (MDM2)
   05202 Transcriptional misregulation in cancer
    107526860 (MDM2)
   05206 MicroRNAs in cancer
    107526860 (MDM2)
   05205 Proteoglycans in cancer
    107526860 (MDM2)
   05203 Viral carcinogenesis
    107526860 (MDM2)
  09162 Cancer: specific types
   05214 Glioma
    107526860 (MDM2)
   05220 Chronic myeloid leukemia
    107526860 (MDM2)
   05218 Melanoma
    107526860 (MDM2)
   05219 Bladder cancer
    107526860 (MDM2)
   05215 Prostate cancer
    107526860 (MDM2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    107526860 (MDM2)
   05169 Epstein-Barr virus infection
    107526860 (MDM2)
   05165 Human papillomavirus infection
    107526860 (MDM2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107526860 (MDM2)
   01522 Endocrine resistance
    107526860 (MDM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107526860 (MDM2)
   04121 Ubiquitin system [BR:mna04121]
    107526860 (MDM2)
Enzymes [BR:mna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     107526860 (MDM2)
Membrane trafficking [BR:mna04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    107526860 (MDM2)
Ubiquitin system [BR:mna04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    107526860 (MDM2)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP zf-RING_2 DUF1229 zf-FPG_IleRS
Other DBs
NCBI-GeneID: 107526860
NCBI-ProteinID: XP_016054946
LinkDB
Position
Unknown
AA seq 491 aa
MCNTNMSMSPDGAVSTSQIPAAEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVIFYLGQY
IMNKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVIVNQQEPSNLGT
SVSENRSHLEGGSNQKDSVQELQEEKPSSSDLVSRPSTSSRRRTISETEENSDELPGERQ
RKRHRSDSISFSFDESLALCVIREIRCERSSSSESTGTPSNPDLDAGVSEPSGDWMDQDS
VSDRFSVEFEVESFNSEDYNLSEEGQELSDEDDEVYQVTVYHAEESDTDSFEDDPEISLA
DYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKEKENMPEESKLENSTQEEEGFDVP
DCKKSTVCDSQESCVEENDEKITQASQSQESEDYSQPSTSSSIIYSSQEDVKEFEREETQ
DKEESVESNFPSNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQ
PIQMIVLTYFS
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgtgcaataccaacatgtctatgtctcctgatggtgctgtaagcacctcacagattcct
gctgcggaacaagagaccttggttagaccaaagccattgcttttgaagttgttaaaatct
gttggtgcacaaaaagacacttatactatgaaagaggttatattttatcttggccagtat
attatgaataaacgattatatgatgagaagcaacagcatattgtgtattgttcaaatgat
cttctaggggatttgtttggagtaccaagtttctctgtgaaagaacacaggaaaatatac
acaatgatctacagaaatttggtaatagtcaatcagcaggaaccatcaaatttaggcaca
tctgtgagtgaaaacaggagtcaccttgaaggtgggagtaatcaaaaggattctgtgcaa
gagctgcaggaagagaaaccttcatcttcagatttggtttctagaccatctacctcatct
agaaggagaacaattagtgagacagaagaaaactcagatgaattacctggtgaacgtcaa
agaaagcgccacagatctgatagtatttccttttcctttgatgaaagccttgctctgtgt
gtaataagggagatacgctgtgaaagaagcagtagcagtgaatcaacagggaccccatca
aatccggatcttgatgctggtgtaagtgaaccatccggtgattggatggatcaagattca
gtttcagatcgattcagtgtagaatttgaagttgagtctttcaattcagaagattataac
ctcagtgaagaaggacaagaactctcagatgaagatgatgaggtatatcaggttactgtg
tatcatgctgaagagagtgatacagattcatttgaagatgatcctgaaatttccttagct
gactattggaagtgtacttcatgcaatgaaatgaatcctcctcttccatcacattgcaac
agatgttgggcccttcgtgagaattggcttcctgaagacaaagggaaagaaaaagaaaac
atgcctgaggaaagcaaactagaaaactcaacacaagaagaagaaggctttgatgtccct
gattgtaaaaaaagtacagtgtgtgattcccaagaatcatgtgttgaggaaaatgatgaa
aagatcacacaagcctcccagtcccaagaaagtgaagactattctcagccgtcgacttct
agtagcatcatttatagcagccaagaagatgtcaaagagtttgagagggaagaaacacag
gacaaagaagaaagtgtggaatctaattttcccagtaatgctattgaaccttgtgtgatt
tgccaaggccgacctaaaaatggttgcatcgtccatggcaaaacaggacaccttatggca
tgctttacctgtgcaaagaagctaaaaaaaagaaataagccctgtccagtatgtagacaa
ccaattcagatgattgtgctaacttatttctcctag

DBGET integrated database retrieval system