KEGG   Miniopterus natalensis: 107526926
Entry
107526926         CDS       T05883                                 

Gene name
HTR2A
Definition
(RefSeq) 5-hydroxytryptamine receptor 2A
  KO
K04157  5-hydroxytryptamine receptor 2
Organism
mna  Miniopterus natalensis
Pathway
mna04020  Calcium signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04540  Gap junction
mna04726  Serotonergic synapse
mna04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107526926 (HTR2A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107526926 (HTR2A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107526926 (HTR2A)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    107526926 (HTR2A)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107526926 (HTR2A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107526926 (HTR2A)
G protein-coupled receptors [BR:mna04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    107526926 (HTR2A)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Other DBs
NCBI-GeneID: 107526926
NCBI-ProteinID: XP_016054991
LinkDB
Position
Unknown
AA seq 470 aa
MDILCVENTSLSSSTNCLMQLNDGTRLYNNDFNSGEANTSDAFNWTVDSENRTNLSCEGC
LSPPCFSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP
IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF
VSFFIPLTIMVITYFLTIKSLQKEATLCLSDLGTRAKLASFSFLPQSSLSSEKLFQRSIH
REPGSYGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGAL
LNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYKS
SQLQKEHKKSSKKDAKTTGNDCTMVPLGKQNSEDAPTDNINTVNEKVSCV
NT seq 1413 nt   +upstreamnt  +downstreamnt
atggatattctttgtgtagaaaacacttctctgagctcaagtacaaactgcttgatgcaa
ctaaatgatggcacaaggctttacaataatgactttaattctggagaagctaacacttca
gatgcatttaactggacagtggactcagaaaatcgaaccaacctttcctgtgagggctgt
ctctcaccaccgtgcttctccttacttcacctccaggagaaaaactggtctgctttgctg
acagctgtagtgattattctgaccattgctggaaacatactcgtcatcatggcagtgtcc
ctagagaaaaagctgcagaatgccaccaactatttcctgatgtcacttgccatagctgat
atgctgctgggcttccttgtcatgcccgtgtccatgttaaccatcctgtatggttacagg
tggcctctgcctagcaagctctgtgcagtctggatttacctggatgtgcttttctccacg
gcttccatcatgcacctctgtgccatctcgctggaccgctacgttgccatccagaacccc
atccatcacagccgcttcaattccagaactaaggcatttctgaaaataattgctgtttgg
accatatcagtaggtatatccatgccaataccagtcttcgggctacaggatgattccaag
gtctttaaggaagggagttgcttacttgctgacgataactttgttctgataggctccttt
gtgtcatttttcatccccttaaccatcatggtaatcacctattttctaactatcaagtca
ctccagaaagaagctactttgtgtttgagtgatcttggcactcgggccaaattagcttct
ttcagcttccttccccagagttccctgtcttcagaaaagctcttccagcggtcgatccac
agggagccagggtcctatggcaggaggactatgcagtccatcagcaatgagcagaaagcc
tgcaaggtgctgggcatcgtcttctttctgtttgtggtgatgtggtgccccttcttcatc
acgaacataatggccgtcatctgcaaagagtcctgcaatgaggacgtcatcggggccctg
ctcaatgtgtttgtttggatcggttacctctcctcagcagtgaacccactggtgtacaca
ctgttcaacaagacctacaggtcagccttttcgcggtatattcagtgtcagtacaaggaa
aataaaaaaccattgcagttaattttagtgaacactatcccagccttggcctacaaatct
agtcaactccaaaaggaacataaaaagagttcaaagaaagatgccaagacaacagggaac
gactgcactatggttcctctaggaaaacaaaattcagaagatgctcctacagacaatatc
aacacagtgaatgaaaaggttagctgtgtgtga

KEGG   Miniopterus natalensis: 107530766
Entry
107530766         CDS       T05883                                 

Gene name
HTR2B
Definition
(RefSeq) 5-hydroxytryptamine receptor 2B isoform X1
  KO
K04157  5-hydroxytryptamine receptor 2
Organism
mna  Miniopterus natalensis
Pathway
mna04020  Calcium signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04540  Gap junction
mna04726  Serotonergic synapse
mna04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107530766 (HTR2B)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107530766 (HTR2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107530766 (HTR2B)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    107530766 (HTR2B)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107530766 (HTR2B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107530766 (HTR2B)
G protein-coupled receptors [BR:mna04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    107530766 (HTR2B)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx Orf78
Other DBs
NCBI-GeneID: 107530766
NCBI-ProteinID: XP_016060166
LinkDB
Position
Unknown
AA seq 479 aa
MALSYRISKQSTIPGLILQSSSDHLISSNWSGLQTESIPEEMKQIGEEQGNKPRWSALLI
LMVIIPTIGGNILVILAVSLEKKLQYATNYFLMSLAVADLLVGIFVMPTALLTIMFEAMW
PLPLVLCPAWLFLDVLFSTASIMHLCAISVDRYIAIKKPIQANQYNSRATAFIKITAVWL
ISIGIAVPVPIKGIKTDLVNRNNITCEMTRERFGNFMLFGSLASFFIPLVIMIVTYFLTI
HALQKKTYLVRNKPPQRLTWLTVSTVFQRDETPCSSPEKVAMLNGSHKDKTLPNSSNDML
MRRMSTAGKKSLQNISNEQRASKVLGIVFFLFLLMWCPFFITNVTLVLCDSCNQTTLKML
LEIFVWIGYVSSGVNPLVYTLFNKTFRDAFGRYITCNYRATKSVKTRRKCSSNIFRNPTA
ENSKFFIKRGMRNGINPAMYQSPRRLRSSTIQSSSIMLLDTLLLTENEGDKGEEQVSYV
NT seq 1440 nt   +upstreamnt  +downstreamnt
atggctctttcttacagaatatccaaacaaagcacaattcctgggctcattttgcagagc
tcatctgatcacttaatctcttctaactggtctggattacagacagaatcgataccagag
gaaatgaaacagattggtgaggagcagggaaacaagccacgctggtcagctcttctgata
ctcatggtgataatacccacaattggtggaaacatacttgttattctggctgtttcactg
gagaaaaagctgcagtatgctaccaattattttctaatgtccctggcagtggctgatttg
ctggttggaatatttgtgatgccaactgccctcttgacaataatgtttgaggctatgtgg
cccctcccacttgttctatgccctgcctggttatttcttgatgttcttttttctactgca
tccattatgcatctttgtgccatttcagtggatcgttacatagccattaaaaagccaatc
caggccaatcaatataactcacgagctacagcattcatcaagattacagcggtgtggtta
atttcaataggcattgctgttccagtccctattaaagggataaaaactgatctagttaat
cgaaataacatcacttgtgaaatgacaagagagcgtttcggcaacttcatgctcttcggc
tcactggcttccttctttatacctctggtgatcatgattgtgacctactttctcactatc
catgctttacagaagaaaacttacttggtcagaaacaagccacctcaacgcctaacgtgg
ttgactgtgtccacagttttccaaagggacgaaacaccttgctcctcacctgaaaaggtg
gcaatgctgaatggttctcacaaggacaaaactctgcccaactcaagcaacgatatgctt
atgcgaagaatgtccactgctggaaaaaagtcactgcagaacatttccaacgaacagaga
gcctcaaaggttctagggattgtgtttttcctctttttgcttatgtggtgcccctttttt
attacaaatgtaactttagttttatgtgattcctgcaaccagactactctcaaaatgctc
ctggagatatttgtatggataggctacgtttcctcaggagtgaatcctttggtctacacc
ctcttcaacaagacatttagggatgcatttggccgatacatcacctgcaattaccgggcc
acaaaatctgtaaaaactcgtagaaaatgctccagtaatatcttccggaatccaacagca
gagaactctaagtttttcataaaacgtggaatgcgaaatgggattaatcctgccatgtac
cagagcccaaggaggctccgaagttcaaccattcagtcttcttcaatcatgctactagat
acacttcttctcaccgaaaatgaaggtgacaaaggtgaagagcaagtcagttatgtatag

KEGG   Miniopterus natalensis: 107537524
Entry
107537524         CDS       T05883                                 

Gene name
HTR2C
Definition
(RefSeq) 5-hydroxytryptamine receptor 2C
  KO
K04157  5-hydroxytryptamine receptor 2
Organism
mna  Miniopterus natalensis
Pathway
mna04020  Calcium signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04540  Gap junction
mna04726  Serotonergic synapse
mna04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107537524 (HTR2C)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107537524 (HTR2C)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107537524 (HTR2C)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    107537524 (HTR2C)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107537524 (HTR2C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107537524 (HTR2C)
G protein-coupled receptors [BR:mna04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    107537524 (HTR2C)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4 UPF0182 DUF1385
Other DBs
NCBI-GeneID: 107537524
NCBI-ProteinID: XP_016069045
LinkDB
Position
Unknown
AA seq 457 aa
MVNLRKAVHSFLVHLIGLLVWQCDISVSPVAAIVTDLFNASDGGRVKFPDGVQNWPALPI
VIIIILTIGGNILVIMAVSLEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVW
PLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWA
ISIGVSVPIPVLGLRDESKVFVNNTTCTLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYV
LRRQALMLLRGHTEELPSVSLDFLKCCRKTTDRENAAKPAQDVKPRKRKKKDKRPRGTMQ
AINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKTCNQKLMEKLLNVFVWIGYVCS
GINPLVYTLFNKVYRRAFSNYLRCNYKAEKKPPVRQIRRIAATALSGRELNVNVYRHTNE
PDTEKANDNEPGIEMQVENLELPVNPANVVSERISSV
NT seq 1374 nt   +upstreamnt  +downstreamnt
atggtgaacctaaggaaagcggtgcactcgttccttgtgcacctaattggccttttggtt
tggcaatgcgatatttctgtgagcccagttgcagccatagtaactgaccttttcaatgcc
tccgatggtggacgcgtcaaattcccagacggggtacaaaactggccagcacttccaatc
gtcataataataatcctgacgataggtggcaacattctcgttatcatggcagtaagcttg
gaaaagaaactgcacaatgccaccaattacttcttaatgtccctagccattgctgatatg
ctcgtgggactgcttgtcatgccactgtctctgcttgcaatcctttatgattatgtctgg
ccactacctagatatttgtgccccgtctggatatctttagatgttttattttcgacagcg
tccatcatgcacctctgcgctatatcgctggatcggtatgtagcaatacgtaatcctatt
gagcatagccgtttcaattcgcggactaaggccatcatgaagattgctattgtttgggca
atttctataggtgtgtcagttccaatcccagtgcttggactgagagatgaaagcaaggtg
ttcgtcaacaacaccacctgcacgctgaacgatccaaacttcgttcttattgggtccttc
gtggctttcttcataccgctgacgatcatggtgatcacctactgcctcacgatctacgtc
cttcgcagacaagccctgatgttactgcgcggccacaccgaggaactgcccagcgtaagc
ctggatttcctgaagtgctgccggaagaccaccgacagggagaacgctgccaagcccgcc
caagacgtgaagccccgcaaaagaaagaagaaagacaaacgtcctaggggcaccatgcag
gctatcaacaatgaacggaaggcatctaaagtcctgggcattgttttctttgtgtttctg
atcatgtggtgcccttttttcatcactaatatcctgtcggttctctgtgagaagacctgt
aatcagaagctcatggaaaagcttctgaacgtgtttgtttggatcggctatgtttgttca
ggaatcaatcctctggtatacactcttttcaacaaggtttaccgacgggctttctccaac
tatctgcgctgcaattacaaggcagagaaaaagcctcctgtcaggcaaatccggagaatt
gctgccactgctttgtccgggagggagctcaacgttaacgtttaccggcacaccaatgaa
ccggacacagagaaagcaaatgacaatgagccggggatagagatgcaagttgagaatttg
gagctcccagtgaatcccgccaatgtggttagcgaaaggattagcagtgtgtaa

DBGET integrated database retrieval system