KEGG   Miniopterus natalensis: 107526945
Entry
107526945         CDS       T05883                                 

Gene name
CHRM5
Definition
(RefSeq) muscarinic acetylcholine receptor M5
  KO
K04133  muscarinic acetylcholine receptor M5
Organism
mna  Miniopterus natalensis
Pathway
mna04020  Calcium signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04725  Cholinergic synapse
mna04810  Regulation of actin cytoskeleton
mna05010  Alzheimer disease
mna05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107526945 (CHRM5)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107526945 (CHRM5)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107526945 (CHRM5)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    107526945 (CHRM5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107526945 (CHRM5)
   05022 Pathways of neurodegeneration - multiple diseases
    107526945 (CHRM5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107526945 (CHRM5)
G protein-coupled receptors [BR:mna04030]
 Rhodopsin family
  Biogenic amine
   Acetylcholine (muscarinic)
    107526945 (CHRM5)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4 7TM_GPCR_Srbc
Other DBs
NCBI-GeneID: 107526945
NCBI-ProteinID: XP_016055014
LinkDB
Position
Unknown
AA seq 532 aa
MEGESYHNATTVNGTPVSHQPLERHGLWEVITVAAVTAVVSLVTIVGNVLVMISFKVNSQ
LKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMN
LLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGERTVPP
DECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSVAEAE
KRKPAHKALLQSCFSCPGPALAQRERSQASWSSSRRSTSTTGKPSQATGPSAEWDKAEQL
TTCSSCPSSEDEDKPAADSDFQVVYRSQAKESPREDFSTEETKETFVKGQTEKNDDDTPK
YFLSPAAAQRPKSQKCVAYKFRLVVKADGAQETNNGCRKVKIMPCSSPVSKDPSTKGLDP
NLSHQMTKRKRMVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLG
YWLCYVNSTVNPICYALCNRTFRKTFKMLLLCRWKKKKVEEKLYWQGNSKLP
NT seq 1599 nt   +upstreamnt  +downstreamnt
atggaaggagaatcttaccacaatgcaactactgtcaatggcaccccagtgagccaccag
cctctggaacgccacgggctgtgggaagtcatcaccgttgccgctgtgacggcggtggta
agcctggtcaccatcgtgggcaacgtcttggtcatgatctccttcaaagtcaacagtcag
ctgaagacagttaacaactactacctgctcagcttggcctgcgcagatctcatcatcggg
atcttctccatgaacctctataccacctacatcctcatggggcgctgggccctggggagt
ctggcttgcgacctctggcttgcgctggactatgtggccagcaacgcttccgtcatgaac
cttctggtgatcagttttgaccgttacttttctatcacgagacccctgacgtatcgggcc
aagcgtaccccaaagagggccggcatcatgattggcctggcctggctgatctccttcatc
ctctgggccccagcaatcctctgctggcagtacttggtcggggagcgaacggtgcctccg
gatgagtgccagatccagttcctctctgagcccaccatcacttttggcactgccatcgct
gccttctacattcctgtttccgtcatgacaattctctactgccgaatctaccgggagaca
gagaagcggaccaaggacctcgctgacctgcagggctcggactctgtggctgaagctgag
aagaggaagccagctcacaaggctctgctgcagtcctgctttagctgccctgggcccgcg
ctggcgcagagggaaaggagccaagcttcctggtcatcctcccgcaggagcacctccacc
accgggaagccctcccaggccactggcccaagcgctgagtgggacaaagccgagcagctc
acgacatgtagcagctgcccctcctcggaagatgaggacaagcccgccgctgactccgac
ttccaggtggtctacaggagccaggccaaggaaagccccagggaagatttcagcactgaa
gagaccaaggaaacttttgtgaaaggtcaaactgaaaaaaatgacgacgacacccccaaa
tacttcctgtctccagcagctgcccagaggcccaagagtcagaaatgtgtggcctataag
ttccggttggtggtaaaagctgacggggcccaggagaccaacaacggctgccgcaaagtg
aaaatcatgccctgctcctccccagtgtccaaggacccttcgacgaaaggcctggatccc
aacctcagccatcaaatgaccaaacgaaagagaatggtccttgtcaaagagaggaaagca
gcccagacgttgagcgccattctcctggccttcatcatcacgtggaccccttataacatc
atggtcctggtttccaccttctgtgacaagtgtgtcccagtcaccctgtggcacttgggc
tactggttgtgctatgtcaatagcactgtcaaccccatctgctatgccctctgcaacaga
accttcaggaagacctttaagatgctgcttctctgccgatggaaaaagaaaaaagtggaa
gagaagttgtactggcaggggaacagcaagctcccctga

DBGET integrated database retrieval system