KEGG   Miniopterus natalensis: 107526945
Entry
107526945         CDS       T05883                                 

Gene name
CHRM5
Definition
(RefSeq) muscarinic acetylcholine receptor M5
  KO
K04133  muscarinic acetylcholine receptor M5
Organism
mna  Miniopterus natalensis
Pathway
mna04020  Calcium signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04725  Cholinergic synapse
mna04810  Regulation of actin cytoskeleton
mna05010  Alzheimer disease
mna05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107526945 (CHRM5)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107526945 (CHRM5)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107526945 (CHRM5)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    107526945 (CHRM5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107526945 (CHRM5)
   05022 Pathways of neurodegeneration - multiple diseases
    107526945 (CHRM5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107526945 (CHRM5)
G protein-coupled receptors [BR:mna04030]
 Rhodopsin family
  Biogenic amine
   Acetylcholine (muscarinic)
    107526945 (CHRM5)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4 7TM_GPCR_Srbc
Other DBs
NCBI-GeneID: 107526945
NCBI-ProteinID: XP_016055014
LinkDB
Position
Unknown
AA seq 532 aa
MEGESYHNATTVNGTPVSHQPLERHGLWEVITVAAVTAVVSLVTIVGNVLVMISFKVNSQ
LKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMN
LLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGERTVPP
DECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSVAEAE
KRKPAHKALLQSCFSCPGPALAQRERSQASWSSSRRSTSTTGKPSQATGPSAEWDKAEQL
TTCSSCPSSEDEDKPAADSDFQVVYRSQAKESPREDFSTEETKETFVKGQTEKNDDDTPK
YFLSPAAAQRPKSQKCVAYKFRLVVKADGAQETNNGCRKVKIMPCSSPVSKDPSTKGLDP
NLSHQMTKRKRMVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLG
YWLCYVNSTVNPICYALCNRTFRKTFKMLLLCRWKKKKVEEKLYWQGNSKLP
NT seq 1599 nt   +upstreamnt  +downstreamnt
atggaaggagaatcttaccacaatgcaactactgtcaatggcaccccagtgagccaccag
cctctggaacgccacgggctgtgggaagtcatcaccgttgccgctgtgacggcggtggta
agcctggtcaccatcgtgggcaacgtcttggtcatgatctccttcaaagtcaacagtcag
ctgaagacagttaacaactactacctgctcagcttggcctgcgcagatctcatcatcggg
atcttctccatgaacctctataccacctacatcctcatggggcgctgggccctggggagt
ctggcttgcgacctctggcttgcgctggactatgtggccagcaacgcttccgtcatgaac
cttctggtgatcagttttgaccgttacttttctatcacgagacccctgacgtatcgggcc
aagcgtaccccaaagagggccggcatcatgattggcctggcctggctgatctccttcatc
ctctgggccccagcaatcctctgctggcagtacttggtcggggagcgaacggtgcctccg
gatgagtgccagatccagttcctctctgagcccaccatcacttttggcactgccatcgct
gccttctacattcctgtttccgtcatgacaattctctactgccgaatctaccgggagaca
gagaagcggaccaaggacctcgctgacctgcagggctcggactctgtggctgaagctgag
aagaggaagccagctcacaaggctctgctgcagtcctgctttagctgccctgggcccgcg
ctggcgcagagggaaaggagccaagcttcctggtcatcctcccgcaggagcacctccacc
accgggaagccctcccaggccactggcccaagcgctgagtgggacaaagccgagcagctc
acgacatgtagcagctgcccctcctcggaagatgaggacaagcccgccgctgactccgac
ttccaggtggtctacaggagccaggccaaggaaagccccagggaagatttcagcactgaa
gagaccaaggaaacttttgtgaaaggtcaaactgaaaaaaatgacgacgacacccccaaa
tacttcctgtctccagcagctgcccagaggcccaagagtcagaaatgtgtggcctataag
ttccggttggtggtaaaagctgacggggcccaggagaccaacaacggctgccgcaaagtg
aaaatcatgccctgctcctccccagtgtccaaggacccttcgacgaaaggcctggatccc
aacctcagccatcaaatgaccaaacgaaagagaatggtccttgtcaaagagaggaaagca
gcccagacgttgagcgccattctcctggccttcatcatcacgtggaccccttataacatc
atggtcctggtttccaccttctgtgacaagtgtgtcccagtcaccctgtggcacttgggc
tactggttgtgctatgtcaatagcactgtcaaccccatctgctatgccctctgcaacaga
accttcaggaagacctttaagatgctgcttctctgccgatggaaaaagaaaaaagtggaa
gagaagttgtactggcaggggaacagcaagctcccctga

KEGG   Miniopterus natalensis: 107539778
Entry
107539778         CDS       T05883                                 

Gene name
CHRM1
Definition
(RefSeq) muscarinic acetylcholine receptor M1
  KO
K04129  muscarinic acetylcholine receptor M1
Organism
mna  Miniopterus natalensis
Pathway
mna04020  Calcium signaling pathway
mna04024  cAMP signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04151  PI3K-Akt signaling pathway
mna04725  Cholinergic synapse
mna04810  Regulation of actin cytoskeleton
mna05010  Alzheimer disease
mna05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107539778 (CHRM1)
   04024 cAMP signaling pathway
    107539778 (CHRM1)
   04151 PI3K-Akt signaling pathway
    107539778 (CHRM1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107539778 (CHRM1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107539778 (CHRM1)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    107539778 (CHRM1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107539778 (CHRM1)
   05022 Pathways of neurodegeneration - multiple diseases
    107539778 (CHRM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107539778 (CHRM1)
G protein-coupled receptors [BR:mna04030]
 Rhodopsin family
  Biogenic amine
   Acetylcholine (muscarinic)
    107539778 (CHRM1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srbc 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 107539778
NCBI-ProteinID: XP_016071837
LinkDB
Position
Unknown
AA seq 460 aa
MNTSAPPAISPNITVLSPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVN
NYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLIS
FDRYFSVTRPLSYRAKRTPRRAALMIGLAWMVSFILWAPAILFWQYLVGERTVLAGQCYI
QFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSS
SERSQPGAEGSPDAPPGRCCRCCPAPRLLQAYSWKEEEEEEEGSMESLTSSEGEEPGSEV
VIKMPMVDPEAQAPSKQPPRSSPNTVKRPTRKGRDRPGRSQKPRGKDQLAKRKTFSLVKE
KKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPGTLWELGYWLCYVNSTVNPMCYAL
CNKAFRDTFRMLLLCRWDKRRWRKIPKRPGSVHRTPSHQC
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgaatacctcggccccacctgccatcagccccaacatcacggtcctttccccaggaaag
gggccctggcaagtggccttcattgggatcaccacgggcctcctgtcgctggccacagtg
acgggcaacttgctggtgctcatctccttcaaggtcaacacggagctcaagacagtcaac
aactacttcctgctcagcctggcctgcgccgacctcatcatcggcaccttctccatgaac
ctctacaccacgtacctgctcatgggccactgggcgctgggcacgctggcctgcgacctg
tggctggccctggactacgtggccagcaatgcctccgtcatgaacctgctgctcatcagc
ttcgaccgctacttctccgtgacccggcccctgagctaccgcgccaagcgcacacctcgc
cgggccgccctgatgatcggcctggcctggatggtttccttcatcctctgggccccggcc
atcctcttctggcagtacctggtgggggagcggacggtgctggccgggcagtgctacatc
cagttcctctcccagcccatcatcaccttcggcaccgccatggccgccttctacctcccg
gtcacggtcatgtgcacgctctactggcgcatctaccgggagacggagaaccgggcccgg
gagctggcggccctgcaaggctccgagacccccgggaaggggggcggcagcagcagcagc
tccgagcggtcccagccgggggccgagggctcccccgacgccccgccagggcgctgctgt
cgctgctgcccggcccccaggctgctgcaggcctacagctggaaggaggaggaggaggag
gaggaaggctccatggagtcgctcacgtcctccgagggcgaggagccgggctccgaggtg
gtgatcaagatgcccatggtggaccccgaggcgcaggccccctccaagcagcccccccgg
agctccccgaacacagtcaagaggccgactcggaagggccgggatcggccgggcaggagc
cagaagccgcgcgggaaggaccagctggccaagcggaagaccttctcgctggtcaaggag
aagaaggcagctcggaccctgagcgccatcctgctggccttcatcctcacctggacaccg
tacaacatcatggtgctggtgtccaccttctgcaaggactgtgtccccgggaccctgtgg
gagctgggctactggctctgctacgtcaacagcacggtcaaccccatgtgctacgcgctc
tgcaacaaggccttccgggacaccttccgcatgctgctgctctgccgctgggacaagcgt
cgctggcgcaagatccccaagcgccccggctctgtgcaccgcaccccctcccaccagtgc
tga

KEGG   Miniopterus natalensis: 107542477
Entry
107542477         CDS       T05883                                 

Gene name
CHRM3
Definition
(RefSeq) muscarinic acetylcholine receptor M3
  KO
K04131  muscarinic acetylcholine receptor M3
Organism
mna  Miniopterus natalensis
Pathway
mna04020  Calcium signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04725  Cholinergic synapse
mna04742  Taste transduction
mna04810  Regulation of actin cytoskeleton
mna04911  Insulin secretion
mna04970  Salivary secretion
mna04971  Gastric acid secretion
mna04972  Pancreatic secretion
mna05010  Alzheimer disease
mna05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107542477 (CHRM3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107542477 (CHRM3)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107542477 (CHRM3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107542477 (CHRM3)
  09154 Digestive system
   04970 Salivary secretion
    107542477 (CHRM3)
   04971 Gastric acid secretion
    107542477 (CHRM3)
   04972 Pancreatic secretion
    107542477 (CHRM3)
  09156 Nervous system
   04725 Cholinergic synapse
    107542477 (CHRM3)
  09157 Sensory system
   04742 Taste transduction
    107542477 (CHRM3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107542477 (CHRM3)
   05022 Pathways of neurodegeneration - multiple diseases
    107542477 (CHRM3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107542477 (CHRM3)
G protein-coupled receptors [BR:mna04030]
 Rhodopsin family
  Biogenic amine
   Acetylcholine (muscarinic)
    107542477 (CHRM3)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx CAF1A
Other DBs
NCBI-GeneID: 107542477
NCBI-ProteinID: XP_016075281
LinkDB
Position
Unknown
AA seq 590 aa
MNLHNNNTTLPLLPNISSFWTPGSPDAGLPPGTATHFGSYNISGAAGNFSPPNGTISDPL
GGHTIWQVVFIAFLTGVLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVI
SMNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKR
TTKRAGMMIGLAWVISFILWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAF
YMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAEAENFVQTTGSSRSCSSYELQQQSV
KRSAGRKYGCCDFWFPAKPWKPSAEHIDQDHSSSDSWNNNDAAASLENSASSDEDDIGSE
TRAIYSIVLKLPGHSTILNSTKLPSSDSLKVPDEEPGTADLERTASKLQAQKSTDDGGGF
QESFSRLPIQLESAVDTAKTSDTNSSVDKTTATRPLSSKEATLAKRFALKTRSQITKRKR
MSLIKERKAAQTLSAILLAFIVTWTPYNIMVLVNTFCNSCIPKTYWNLGYWLCYINSTVN
PVCYALCNKTFRTTFKALLLCQGGRRRRRRQQLQQRQSVTFPRRVPGQDL
NT seq 1773 nt   +upstreamnt  +downstreamnt
atgaacttgcataataacaatacaactttgccattgttgccaaacatcagctctttctgg
acacctggctccccagatgcagggctgcccccaggaacagccactcattttggcagttac
aacatttctggagcagctgggaatttctctccgccaaatggcaccatcagtgaccctctg
ggaggtcataccatctggcaggtggtcttcattgcattcttaacaggtgtcctggccctg
gtgaccatcattggcaatatcctagtgatagtggcatttaaggtcaacaagcagctgaag
actgtcaataactacttcctcttaagcctggcctgtgctgatctgattattggggtcatt
tcaatgaatctgtttactacctacatcattatgaatcgatgggctctagggaacctggcc
tgtgacctctggctttccattgactatgtggctagcaacgcctcggttatgaatctcctg
gtgattagctttgacaggtacttttccatcacaaggccactcacataccgggccaaaaga
acaaccaaaagggctggcatgatgataggtctggcttgggtcatatccttcatcctgtgg
gctccggccatcttgttctggcagtactttgttgggaagagaactgtgcccccaggagaa
tgcttcattcagtttctcagtgagcccaccattacctttggcacggccatcgctgccttt
tatatgcctgtcaccattatgactattttatactggaggatctataaggaaaccgaaaaa
cgtaccaaagagctggctggactgcaagcctctgggacagaagcagaggcagaaaacttt
gtccaaaccacaggcagttctcgaagctgcagcagctatgaactgcaacaacaaagcgtg
aagcgctcagccgggaggaagtacggctgctgcgacttctggttcccagccaagccctgg
aagcccagtgccgagcacatagaccaagaccacagcagcagcgacagctggaacaacaac
gacgctgccgcctccctggagaactcggcgtcctctgatgaggacgacattggctcagag
accagagccatctactccatcgtgctcaagcttccaggtcacagcaccatcctaaactcc
accaagttaccctcatcagacagcctgaaggtgcccgatgaagagccggggacagcggac
ttggagaggacagccagcaagctgcaggcccagaagagcacagatgacggaggcggattt
caagaaagtttctccaggcttcccatccagttagagtcggccgtggacacagccaagacc
tctgacaccaactcgtcagtggataagaccacggccactcggcctctgtcctccaaggaa
gccactctggccaagaggtttgccctgaagaccagaagccagatcaccaagcggaaacgg
atgtcgctcatcaaggagaggaaggcggcgcagacgctcagcgccatcctgctcgccttc
atcgtcacctggacgccctacaacatcatggtcctggtgaacaccttctgcaacagctgc
attcccaagacctactggaacctgggctactggctctgctacatcaacagcaccgtgaac
cccgtgtgctatgccctgtgcaacaagaccttccggaccaccttcaaggcgctgctgctg
tgccagggcggccggcggaggcggcgccggcagcagctccagcagagacagtcggtgacc
ttcccccggcgcgtgcccgggcaggacttgtag

DBGET integrated database retrieval system