KEGG   Miniopterus natalensis: 107526989
Entry
107526989         CDS       T05883                                 

Gene name
RYR3
Definition
(RefSeq) ryanodine receptor 3
  KO
K04963  ryanodine receptor 3
Organism
mna  Miniopterus natalensis
Pathway
mna04020  Calcium signaling pathway
mna04371  Apelin signaling pathway
mna04713  Circadian entrainment
mna04921  Oxytocin signaling pathway
mna04970  Salivary secretion
mna05010  Alzheimer disease
mna05012  Parkinson disease
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107526989 (RYR3)
   04020 Calcium signaling pathway
    107526989 (RYR3)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107526989 (RYR3)
  09154 Digestive system
   04970 Salivary secretion
    107526989 (RYR3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107526989 (RYR3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107526989 (RYR3)
   05012 Parkinson disease
    107526989 (RYR3)
   05020 Prion disease
    107526989 (RYR3)
   05022 Pathways of neurodegeneration - multiple diseases
    107526989 (RYR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107526989 (RYR3)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Ryanodine receptor
   107526989 (RYR3)
SSDB
Motif
Pfam: RYDR_ITPR RyR RR_TM4-6 SPRY Ins145_P3_rec MIR RIH_assoc Ion_trans EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5 EF-hand_8
Other DBs
NCBI-GeneID: 107526989
NCBI-ProteinID: XP_016055102
LinkDB
Position
Unknown
AA seq 4846 aa
MAKEDVEEDEVVLQCVANVHKEQRKFCLAAEGLGNRLCFLEPTSEAKYVPPDLCVCNFVL
EQSLSVRALQEMLANTGENGGEGAAQGGGHRTLLYGHAILLRHSFSGMYLTCLTTSRSQT
DKLAFDVGLQEHASGEACWWTIHPASKQRSEGEKVRIGDDLILVSVSSERYLHLSISSAN
IQVDASFMQTLWNVHPTCSGSSIEEGYLLGGHVVRLFHGHDECLTIPSTDQNDSQHRRIF
YEAGGAGTRARSLWRVEPLRISWSGSNIRWGQAFRLRHLTTGHYLALTEDQGLMLQDRGK
SDTKSTAFSFRASKEIKEKLDSSHKRDIEGMGVPEIKYGDSVCFVQHVASGLWVTYKAQD
AKTSRLGPLKRKVILHQEGHMDDGLTLQRCQREESQAARIIRNTTALFSQFISGNNRTAA
PITLPIEEVLQTLQDLIAYFQPPEEEMQHEAKQNKLRSLKNRQNLFKEEGMLALVLNCID
RLNIYNSVAHFAGIAREESGMAWKEILNLLYKLLAALIRGNRNNCAQFSNNLDWLISKLD
RLESSSGILEVLHCILIESPEALNLIAEGHIKSIISLLDKHGRNHKVLDVLCSLCLCNGV
AVRANQNLICDNLLPRRNLLLQTRLINNVTSIRPNIFLGVAEGSAQYKKWYFELIIDQVE
PFLTAEPTHLRVGWASSSGYAPYPGGGEGWGGNGVGDDLYSYGFDGLHLWSGRIPRAVAS
INQHLLKSDDVVSCCLDLGVPSISFRINGQPVQGMFENFNTDGLFFPVVSFSAGVKVRFL
MGGRHGEFKFLPPSGYVPCYEALLPKEKMRLEPVKEYKRDTEGIRDLLGTTQFLSQASFT
PCPIDTSQVVLPPHLEKIRDRLAENIHELWGMNKIELGWTFGKIRDDNKRQHPCLVEFSK
LPETEKNYNLQMSTETLKTLLALGCHIAHVNPAAEENLKKVKLSKNYMMSNGYKPAPLDL
SDVKLLPSQEILVDKLAENAHNVWAKDRIKQGWTYGIQQDLKNKRNPRLVPYALLDERTK
KSNRDSLREAVRTFVGYGYNVEPSDQELADPAVEKISIDKIRFFRVERSYAVRSGKWYFE
FEVVTGGDMRVGWARPGCRPDVELGADDQAFVFEGSRGQRWHQGSGYFGRTWQPGDVVGC
MINLDDASMIFTLNGELLITNKGSELAFADYEIENGFVPICSLGLSQIGRMNLGMDASTF
KFYTMCGLQEGFEPFAVNMNRDVAMWFSKRLPTFVNVPKDHPHIEVVRIDSTMDSPPCLK
VTHKTFGTQNSNASMIYLRLSMPVECHSSFSHSPCLDSDAFQKRKQMQEILSQTTTQCYY
AIRIFAGQDPSCVWVGWVTPDYHLYSEKFDLNKNCTVTVTLGDERGRVHESVKRSNCYMV
WGGDIVATSQRSSRSNVDLEIGCLVDLAMGMLSFSANGRELGTCYQVEPNTKVFPAVFLQ
PTSTSLFQFELGKLKTALPLSAAIFKSEEKNPVPQCPPRLDVQTIQPVLWSRMPSSFLKV
ETERVSERHGWVVQCLEPLQMMALHIPEENRCVDILELCEQEDLMQFHYHTLRLYSAVCA
LGNSRVAYALCSHVDLAQLFYAIDNKYLPGLLRSGFYDLLISIHLASAKERKQMMKNEYI
IPITSTTRKIRLYPDESKRHGLPGVGLRTCLKPGFQFSTPCVVLTSEEHQKQSPEIPLEI
LKMKALGMLTEAVQCSGAHIRDPVGGSVQFQFVPVLKLIGTLLVMGVFDDDDVRQILLLI
DPSMFGEHSGDTEEGAEKEEVTQVEEKAVEAGEKAGKEAPVKGLLQTRLPESVKLQMCEL
LSYLCDCELQHRVEAIVAFGDIYVSKLQTNQKFRYNELMQALNMSAALTARKTKEFRSPP
QEQINMLLNFQLGENCPCPDEIREELYDFHEDLLTHCGVPLEEEEEEAEDTSWAGKLRAL
LQKIKGPPKAQKSQPAAEEEKCPTTLKELISQTMIRWAQEDQIQDADLIRMMFSLLRRQY
DSIGELLQALRKTYTISQASVSDTINLLAALGQIRCLLSVRMGKEEELLMINGLGDIMNN
KVFYQHPNLMRVLGMHETVMEVMVNVLGAEKSQIAFPKMVASCCRFLCYFCRISRQNQKA
MFEHLSYLLENSSVGLASPSMRGSTPLDVAASSVMDNNELALGLEEPDLEKVVTYLAGCG
LQSCPMLLAKGYPDVGWNPIEGERYLSFLRFAVFVNSESVEENASVVVKLLIRRPECFGP
ALRGEGGNGLLAAMQGAIKISENPALDLPSQGYKREVTEDTEDEEEIVHMGNAIMSFYSA
LIDLLGRCAPEMHLIQTGKGEAIRIRSILRSLVPTEDLVGIISIPLKLPSLNKDGSVSEP
DMAANFCPDHKAPMVLFLDRVYGIKDQTFLLHLLEVGFLPDLRASASLDTVSLSTTEAAL
ALNRYICSAVLPLLTRCAPLFAGTEHYASLIDSTLQTIYRLSKGRSLTKAQRDTIEECLL
AICNHLRPSMLQQLLRRLVFDVPQLNEYCKMPLKLLTSHYEQCWKYYCLPSGWGSYGLAV
EEELHLTEKLFWGIFDSLSHKKYDPDLFRMALPCLSAIAGALPPDYLDTRISATLEKQIS
VDADGNFDPKPINTMNFSLPEKLEYIVTKYAEHSHDKWACDKSQNGWKYGISLDENMKTH
PLIRPFKTLTEKEKEIYRWPARESLKTMLAVGWTVERTKEGEALVQQRENEKLRSVSQAS
QGNSYSPAPLDLCNVVLSRELQGMVEVIAENYHNIWAKKKKLELESKGGGSHPLLVPYDT
LTAKEKSRDREKAQDLFKFLQVNGIVVSRGMKDMELDASSMEKRFAYKFLKKILKYVDSA
QEFIAHLEAIVISGKTERSPHDQEIKFFAKVLLPLVDQYFTNHRLYFLSSPLKPLSSSGY
ASHKEKEMVASLFCKLAALVRHRISLFGSDSTTMVSCLHILAQTLDTRTVMKSGSELVKA
GLRAFFENAAEDLEKTSENLKLGKFTHSRTQIKGVSQNINYTTVALLPILTSIFEHVAQH
QFGVDLLSGDVQISCYHILCSLYSLGTGKNIYVERQRPALGECLASLAAAIPVAFLEPSL
NRYNPLSVFNTKTPRERSILGMPDTVEEMCPDIPPLERLMKEIHRLAESGARYTEMPHVI
EVILPMLCNYLSYWWEQGPEHLPPSTGPWCTKVTSEHLSIILGNILKIINNNLGIDEASW
MKRIAVYAQPIISKARPDLLRSHFIPTLEKLKKKAVKTVQEEEQLKADSKGDTQEAELLI
LDEFAVLCRDLYAFYPMLIRYVDNNRSNWLKSPDANSDQLFRMVAEVFILWCKSHNFKRE
EQNFVIQNEINNLAFLTGDSKSKMSKSGGQDQERKKTKRRGDLYSIQTSLIVAALKKMLP
IGLNMCTPGDQELISLAKARYSYRDTDEEVKEHLRNNLHLQEKSDDPAVKWQLNLYKDVL
KSEEPSNPEKTVERVQRISAAVFHLEQVEQPLRSKKAVWHKLLSKQRKRAVVACFRMAPL
YNLPRHRSINLFLHGYQRFWIETEEYSFEERLVQDLARSPKVEEEEEMETERQPDPLHQI
VLHFSRNALTERSTLEDDPLYTSYSSMMAKSCENGEDEEEEDKEKTFEEKEMEKQKTLYQ
QARLHERGAAEMVLQMISASKGEMSPMVVETLKLGIAILNGGNAGVQQKMLDYLKEKKDA
GFFQSLSGLMQSCSVLDLNAFERQNKAEGLGMVTEEGTREKVLQNDEFTRDLFRFLQLLC
EGHNNDFQNFLRTQMGNTTTVNVIISTVDYLLRLQESISDFYWYYSGKDIIDESGQHNFS
KALAVTKQIFNSLTEYIQGPCIGNQQSLAHSRLWDAVVGFLHVFANMQMKLSQDSSQIEL
LKELLDLLQDMVVMLLSLLEGNVVNGTIGKQMVDTLVESSTNVEMILKFFDMFLKLKDLT
SSDTFREYDPDGKGIISKKEFQKAMEGQKQYTQSEIDFLLSCAEADENDMFNYIDFVDRF
HEPAKDIGFNVAVLLTNLSEHMPNDSRLKCLLDPAESVLNYFEPYLGRIEIMGGAKKIER
VYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEQEKMELFVNFCEDTIFEMQLASQIS
ESDAADRPDEEEEDEEDSPYAAETEGGQEDASFESASAFALACASGKRSVAGFLKRATLR
NLRKQWRAVRKMTVKELVRVFLSFFWALFVGLFQLFFAVLGGVFQILWNTVFGGGLVEGA
KNIRVTKILGDMPDPTQFGIHDDAVEAERAEGTEPGIATDLGHFLKGEKGDADLVSDPFG
LHPKREGGLKHGPEAGLGDLSEIIGKDEPPTLESTVRKKRKAQAAEMKAAHESEGKVEPE
KADMEDGEKEETAGEERAKALWAEATKKKKRRRGQKVEKPEAFMANFFKGLEVYQTKLLH
YLARNFYNLRFLALFVAFAINFILLFYKVTEEPLEEETEDVANLWHSFNDDEEEEAMVFF
VLQESTGYMAPALRALAVVHTIISLVCVVGYYCLKVPLVVFKREKEIARKLEFDGLYITE
QPSEDDIKGQWDRLVINTPSFPNNYWDKFVKRKVINKYGDLYGAERIAELLGLDKNALDF
SPVEETKAEAASLVSWLSSIDMKYHIWKLGVVFTDNSFLYLAWYTTMSILGHYNNFFFAA
HLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDDDD
PDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDPYEMYRIVFDITFFFFVIVILLAI
IQGLIIDAFGELRDQQEQVREDMETKCFICGIGNDYFDTTPHGFETHTLQEHNLANYLFF
LMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQLG
NT seq 14541 nt   +upstreamnt  +downstreamnt
atggccaaagaagatgtggaggaagacgaggtggttctccagtgcgttgccaacgttcac
aaggagcagaggaagttctgcctggcagccgagggccttgggaatcgcctgtgcttcttg
gaacccacttcagaagccaagtatgttcctccagatctctgcgtctgcaattttgtgctg
gagcagtccctctcagtccgagccctgcaggaaatgcttgccaacacaggtgaaaacggc
ggagaaggggcagcacaagggggtggccacaggaccctgctgtacggccacgcgattctc
ctgcggcactccttcagcgggatgtatctgacatgtttgactacatcaagatcccagaca
gataaacttgcctttgatgtaggtctacaggaacatgcctcaggagaagcctgttggtgg
accatacaccccgcttccaaacagaggtccgagggagaaaaagttcgcattggggatgac
ctcatccttgtcagcgtgtcctctgaaagataccttcacctctcaatatccagtgcgaac
atacaagtggatgcctcctttatgcaaacactctggaatgtacatcctacgtgctcggga
agtagcatcgaagaaggatacctgcttggtgggcatgtagtacgtcttttccatgggcat
gatgagtgtttgacgataccatctacagaccagaatgactcccagcacaggaggatattc
tacgaagctgggggagctgggacacgagccagatctctgtggagagtggaacccctacgg
ataagctggagcggcagtaacatcagatggggccaggctttccggctgcggcatctcacc
acaggccactacctggccttgaccgaggaccaaggccttatgctgcaagaccggggaaag
tcagacaccaagtccacagccttctctttcagggcatcaaaggaaatcaaggagaaattg
gattccagtcacaaaagagatatagaaggcatgggagtccctgaaatcaagtatggagat
tctgtctgctttgtccagcatgtagccagcggtctgtgggtgacctacaaagcacaagac
gctaagacatcccgcctgggacccctgaaaagaaaggtcatcctccaccaggaaggccac
atggatgacggattaacactgcagagatgccagcgcgaggagtcccaggcagctcggatc
atccggaacacaacagccttattcagccagttcataagtggaaacaatcgcacagctgcc
cccatcaccctgccgatagaagaggtcctgcagaccttgcaggacttgatcgcctacttc
cagcccccggaggaggagatgcagcatgaagccaagcagaacaagcttcgctcgctcaaa
aacagacagaatcttttcaaggaagagggaatgttggcccttgtattaaattgcattgat
cgcttaaatatctacaacagcgtagcacactttgcagggatcgcaagggaggagagtggc
atggcctggaaagaaatcctcaacctcctgtacaaattgctggctgccctcatccgtgga
aacagaaacaattgtgcgcagttctccaataaccttgattggctaatcagcaagttggac
agactagaatcttcctcaggtatcctggaagtcttgcactgcatcttgattgaaagccca
gaagccttaaacctgatcgcagagggtcacatcaagtccatcatctccctgctggataag
cacgggcggaaccacaaggttttggatgtgctgtgctccctctgtctctgcaatggggtg
gccgtgagagccaaccagaatctgatctgtgacaacttgctgcctcggagaaacctgctc
ctgcagacacggctgattaacaatgtgacaagtattcggccaaacatcttcctgggagtg
gctgagggctcggcacagtacaagaagtggtacttcgagctcataattgaccaggtggag
cccttcctcacggcggagcccacacacctgcgggtgggctgggcctcctcctcgggctac
gcgccctaccccggaggcggagaaggctggggaggcaacggtgtgggtgacgacctgtac
tcctacggctttgatggacttcacctttggtcaggccgcattcccagagctgtggcctcc
atcaaccagcacctcctgaaatcggacgacgtggtgagctgctgcctggacctgggggtg
cccagcatctctttccgcatcaacgggcagccggtgcaggggatgtttgagaacttcaac
actgatgggctcttcttccctgtggtgagcttttcagcaggtgtcaaagtacgcttcctg
atgggtggacgtcacggagaatttaagttcctgcctccctctggctatgtcccttgctat
gaagccttacttcccaaagaaaagatgagattggagcctgtcaaagaatataaacgtgac
actgaaggcattagagatctgttgggaaccacccagttcctctcccaagcctccttcacc
ccatgccccatagacaccagtcaggtggttttgccacctcacctagagaagatccgagac
agactggctgaaaacatccacgagctttggggaatgaacaaaatagagctcggctggact
tttggcaagatacgggatgacaataaaaggcaacacccctgccttgtggagttttcaaag
ctgcccgaaactgagaagaattataacctgcaaatgtcaactgaaaccttaaaaaccctc
ctggccttggggtgccacatcgctcatgttaaccccgctgctgaagagaatcttaagaag
gtcaaactgtccaaaaactacatgatgtccaatggctataagccggcccctttggatttg
tctgatgtgaagctattaccttctcaggaaattttagtggataagcttgcagaaaatgca
cataatgtctgggcaaaagacagaataaaacaaggatggacctatggcattcaacaggat
ttgaagaacaaaagaaacccccgtctggtgccatatgcgttactggatgagcgtaccaag
aagtcaaacagggacagccttcgggaagctgttcggacattcgttggttatggctacaac
gtggagccatcagaccaagaactagctgacccagctgtggaaaaaatcagcatagacaag
atccggtttttccgggtagagcggtcttatgcagtgagatctggaaagtggtattttgag
tttgaggtggtgaccggaggagacatgcgtgttggctgggccaggccaggctgtcggcct
gatgttgagctgggggccgatgaccaagcctttgtgtttgaaggcagcaggggccagcgc
tggcatcaagggagtgggtattttggacgtacctggcaaccaggagatgtggttggatgt
atgattaacctcgatgatgcttcaatgatcttcaccctgaatggggagctgctaatcacc
aataaaggctcagaacttgccttcgcggattacgagattgagaatggctttgtgcccatc
tgctctctgggactgtctcagatcggccgcatgaatctcgggatggacgccagtaccttc
aagttttataccatgtgcggcctccaagagggctttgagccttttgctgtcaacatgaac
cgagatgttgcgatgtggttcagcaagcgcctcccgacatttgtcaacgtgccgaaggat
catccccatatagaggttgtgaggatcgacagcaccatggacagccctccatgcctcaag
gtgactcacaagacattcggcacacagaacagcaatgccagtatgatctaccttcgcctg
agcatgcccgtcgagtgccactcctccttcagccacagcccctgcctggacagtgacgct
ttccagaaaaggaaacagatgcaagaaatactctctcaaacaaccacacagtgctactat
gcgatccgcatctttgccggacaggatccctcctgcgtctgggtcggatgggtgactccg
gactatcacctatacagtgaaaagtttgacctgaataaaaactgtacagtgactgttact
ctgggggatgaaagaggccgagtccatgaaagtgtgaagcgcagcaactgctacatggtc
tggggtggggacattgtggccacttcccagcgatcaagccgcagcaacgtggacctggag
atcggctgccttgtggatctggcaatgggcatgttgtccttctcggccaatgggagagag
cttggcacctgctaccaggtggagcccaataccaaagtgttcccagcagtcttcctgcag
cctaccagcacttctttgttccagtttgaacttgggaagctgaagactgcgttgcccctg
tcagcagccatatttaagagcgaagagaagaacccagtcccgcagtgtcccccgcggctg
gacgtgcagaccatccagcccgtgctctggagccgcatgcccagcagcttcctgaaggtg
gagacggagcgggtgagcgagcgccatggctgggtggtgcagtgcctggagcccctgcag
atgatggcgctgcacatccccgaggagaacaggtgtgtggacatcctggagctctgtgag
caggaggacctgatgcagttccattaccacacgctgagactctacagcgctgtgtgcgcc
ctgggaaacagccgagttgcctacgccctgtgcagccacgtggacctcgcccagctcttc
tacgccattgataacaagtacctccctggcctccttcggtctggtttctatgacctgctc
atcagcatccatctggccagcgctaaggagagaaagcagatgatgaagaatgaatacatc
atccccattaccagcaccaccaggaaaatccgcctgtacccagatgagtccaagaggcac
gggctgcctggggtgggcctgagaacgtgcctgaagccaggcttccagttctccacccct
tgcgttgtcctgaccagtgaggagcaccagaagcagagccccgagattcccttggagatt
ctgaaaatgaaggcgctgggcatgctgacagaggccgtgcagtgcagtggggctcacatc
cgagaccctgttggggggtctgtgcagttccagttcgtgcctgtgctgaaactcatcgga
accctactggtcatgggggtgtttgacgatgatgacgttcggcagattctcctcctgatc
gatccgtctatgtttggggagcacagtggagacacagaagagggagcagagaaggaggaa
gtgactcaggtggaggagaaggcagtggaggctggggaaaaggccggcaaggaggctcca
gtcaaaggcttgctgcagacccgattacccgagtccgtcaagctgcagatgtgtgagctc
ctcagctacctctgtgactgtgagctgcagcaccgggtggaggccattgtggcatttggt
gacatttatgtctccaagctccagacaaatcagaagttccgctacaatgagctcatgcag
gccctgaacatgtctgcggccctgaccgcccggaagaccaaggagttccgctcaccccca
caggagcagatcaacatgctgcttaactttcaactgggagagaactgcccctgcccagac
gagatccgggaggagctgtatgacttccacgaggacctcctcacccactgcggggtgccc
ctggaggaggaagaggaggaggcggaggacacctcctgggcgggcaagctccgagccttg
ctgcagaaaatcaaaggccctcccaaggcgcagaagtctcagccggcagcggaagaagag
aaatgcccgactacactgaaggaactcatctcccagacgatgatccgctgggcccaggag
gaccagatccaggacgcagacctaatccggatgatgttcagcctcctccggaggcaatac
gacagcatcggggagctgctgcaggccctgcggaagacctacaccatcagccaggcctcc
gtgagcgacaccattaacctgctggctgccctgggccagattcgctgcctcctcagtgtc
aggatgggcaaggaagaggagctgctcatgatcaatgggctgggagacataatgaacaac
aaggtgttttaccagcaccccaacctcatgcgggtcctcggcatgcacgagacggtgatg
gaggtgatggtgaacgtgctgggtgcagagaaatctcagatcgcttttccaaagatggtt
gccagctgttgccgcttcctttgctatttctgtcgaatcagccggcagaatcagaaggcc
atgtttgagcatctgagttacctgctagagaacagcagtgttggcctagcctccccatcg
atgaggggatccactccgctagatgtggcggcttcctccgtgatggacaacaacgagtta
gcactgggcctagaggaaccagacctcgagaaggtggtgacttacttggcaggctgtggt
ctacagagctgccccatgctgctggccaaagggtaccctgacgtaggctggaaccccatt
gaaggggagcgttacctgtccttcctgaggtttgccgtcttcgtgaacagtgaaagtgtc
gaagaaaatgccagtgtggtggtcaagctgctcatcagacgcccggagtgcttcggccca
gccctgcggggggaaggtggaaatggcctgttggcagccatgcagggagccattaagatc
tccgagaacccagccctcgacctcccctctcagggatacaagagagaagtcacagaagac
actgaagacgaagaagagatcgtgcacatgggcaatgcaattatgtcattttattcagct
cttatagatctactaggccgctgtgctcctgaaatgcaccttatccagacaggaaagggg
gaagccatccggatcaggtcaatcctgcgctcccttgtccccaccgaggacttggttgga
atcatcagcatccccttgaagctgccctccctgaacaaagatggatctgtcagtgagccg
gatatggcagccaacttctgccctgaccacaaggcccccatggtgctattcttggaccgc
gtttatggaattaaggatcaaacttttctgctccacttgctggaggttggatttttacct
gacttaagagcctctgcctctctagatacagtgtccctcagcaccacggaggctgcgctg
gcgctaaataggtacatatgttctgcggtgctcccgctcctcaccaggtgcgcccctctc
tttgccgggacagaacactacgcctccttaatcgattccacactgcagacaatctatagg
ctttccaaggggcgttccctcaccaaggctcagagagacaccatagaagaatgtttactt
gccatttgcaatcacctgaggccctccatgctgcagcagctcctgcggcgcctggtgttc
gatgtgccccagctcaacgagtactgcaaaatgcctctgaagctcctgacgagccactat
gagcagtgctggaagtattactgcctgccttcggggtggggcagctacggcctcgccgtg
gaggaagagctgcacctcacagagaagctcttctgggggatttttgactccctctcccat
aagaagtatgacccggatctgttccgaatggccctgccttgtctcagtgctattgccggg
gccttgccacccgattacttagacaccagaatctcggccacattggagaagcagatctca
gtggatgcagatggcaactttgaccccaagcccatcaacaccatgaatttctccttgcct
gaaaaactggaatacatcgtcaccaagtatgctgagcattcgcatgataaatgggcctgt
gacaagagtcagaatggatggaaatatggaatttccctggacgaaaacatgaagacgcac
ccattgataaggcctttcaagacgttaacggagaaggagaaggaaatttaccgctggcca
gccagagagtccctgaaaaccatgctggctgtgggctggactgtggagaggaccaaggaa
ggagaagcccttgttcaacaacgggaaaatgagaagcttcgaagcgtgtcccaggccagc
cagggcaacagctacagccctgcccccctggacctctgcaacgtggtgctgtccagagag
ctgcagggaatggtggaggtcatagctgagaactatcacaacatctgggccaagaagaag
aagctggagctggagagcaaaggtggtggcagtcaccctctattggtaccgtatgacacc
ttgaccgccaaggagaagtctagggaccgagagaaggcacaggacctgtttaaattcctc
caggtgaatggcatcgtggtttctagaggtatgaaggacatggagctggatgcctcctcc
atggaaaagaggtttgcctataagtttttgaagaagatcctgaaatatgttgattctgct
caagagtttattgcccatctggaagccattgtcatcagtgggaaaactgaacggtctccc
catgaccaggagatcaaattctttgccaaagtcctcctcccgctggttgaccagtacttc
accaaccaccgcctctacttcctgtcgtcccctctgaagccccttagcagcagcgggtac
gcctcccacaaggagaaagaaatggtagccagcctgttctgcaaacttgctgctcttgtt
cggcacaggatttccctcttcgggagcgattctactacaatggtgagctgtcttcacatc
ttagctcagacactcgacacgaggacggtcatgaagtcgggctccgagctggtgaaggcc
gggttacgcgcgttctttgaaaacgctgcggaagacttagagaagacttcggaaaaccta
aagctcgggaagttcacccattccaggacgcagattaaaggcgtctctcagaacattaac
tacaccacggtggcgctgctccccatcctgacgtccatctttgagcacgtggctcagcac
cagttcggggtggatttactctcgggtgacgtgcagatttcatgctaccacatactgtgt
agcctctactcccttgggacggggaagaacatctatgttgaaagacaacgtcctgccctt
ggagaatgtctggcttcactggcagctgccatcccagtggcattcctggagccctccctt
aaccgctacaatccactctcagtcttcaacaccaaaacccccagggagagatctattctg
gggatgccggacacggtggaagagatgtgtcccgacatcccgccgctggaacgcctcatg
aaggagatccaccgcctggccgagtccggggcccggtacacagagatgccccacgtcatc
gaggtgatcctgcccatgctctgcaactacctgtcctactggtgggagcaggggcctgag
cacctgccccccagcacggggccctggtgcaccaaagtcacctcggaacaccttagcatc
atcctgggcaacatcctgaaaatcatcaacaacaacctgggcatcgacgaggcctcctgg
atgaaacgtatcgcagtgtacgcccagcccatcatcagcaaagccaggcctgacctgctc
agaagtcacttcatcccaactctggagaagctgaagaaaaaagctgtcaagactgtgcag
gaggaggagcagctgaaagctgacagcaaaggggacactcaggaggcagagctcctcatc
ctggatgagtttgcagtgctctgcagagacctctatgccttctaccccatgctgatccgc
tacgtggacaacaacagatctaactggctcaaaagccccgatgctaattctgaccagctc
ttccgcatggtggctgaggtcttcatcctgtggtgcaagtctcacaacttcaagagggaa
gagcaaaattttgtgattcagaacgaaattaataatttggcatttttaactggagacagc
aaaagcaagatgtcaaaatctggaggacaggaccaggaacggaagaagacgaagcggagg
ggagacttgtattccatccagacctccctcatcgtggctgcactcaagaaaatgctgcct
attggtttgaatatgtgcaccccaggcgaccaggagctgatctccctcgcaaaagcacga
tacagctatagggacacagatgaagaggtgaaggaacacctgcggaataacttgcacttg
caggaaaagtctgatgacccagctgtaaagtggcaactgaacctctacaaggatgttttg
aagagtgaagaaccttccaatccagaaaagacagtggagcgtgtgcagagaatttcagca
gctgtcttccacctggagcaggtggagcagcctttgaggtccaagaaggcagtctggcac
aaactgttgtctaagcagcggaagcgggcagtggtggcctgtttcaggatggcccctctc
tacaacctgcccaggcaccgctctattaacctcttcctccatggctatcagagattttgg
atagaaacagaggagtattcctttgaagagagactagtacaggatctggctagatctccc
aaggtggaagaggaggaggagatggagacggagaggcagccagacccactccaccagatc
gtgctccactttagccgcaatgctctcacggagaggagcacattggaagacgaccctctg
tacacctcctattccagcatgatggccaagagttgtgagaatggggaagatgaagaggag
gaagacaaggaaaaaacattcgaagaaaaagaaatggaaaagcagaaaaccctctatcag
caagctcggctgcacgagcgcggagccgctgagatggtccttcagatgataagcgccagc
aaaggtgagatgagccccatggtggttgagactctgaagctggggatcgccattctgaat
ggaggcaatgcaggcgtgcagcagaaaatgttagattacctgaaggagaagaaggatgct
gggttctttcaaagcctttctggtctgatgcagtcttgcagtgtccttgatttgaatgca
tttgagagacagaataaagctgaaggcctggggatggttactgaggaaggaacacgtgaa
aaagtactccagaatgacgagttcacacgcgatctctttagattcctgcagttactttgt
gaaggacataacaatgactttcagaacttcctgcggactcagatgggcaacaccaccacc
gtgaatgtcatcatcagtaccgtggactacctcctgcgtcttcaggaatcaatcagtgat
ttctactggtattactcagggaaggacataattgatgaatctggacagcacaatttttcc
aaagctctggcggtcacaaagcagattttcaattctcttacagaatacatccagggccct
tgcattgggaaccagcagagcctggctcacagccggctgtgggatgcggtggtcggcttc
ctccacgtgtttgctaacatgcagatgaaactctcccaggattccagtcagatcgagctg
ctgaaggaactcttggatctccttcaggacatggtggtgatgcttctgtccctcctggaa
gggaatgtggtaaatggaactattggcaagcagatggttgacacactggtagagtcatct
accaatgtagaaatgatcttgaaattctttgacatgttcttgaaacttaaagacttaacc
agctcagacaccttccgagaatatgaccccgatgggaaagggattatctccaaaaaagaa
ttccagaaggccatggaagggcaaaaacagtacacacagtcagagattgactttctcctt
tcttgcgcggaagctgacgagaatgacatgtttaattacatcgatttcgtagaccggttc
cacgagccggccaaggacatagggtttaacgtggcagtgttactgaccaacctctcggag
cacatgcccaacgactcccgcctcaagtgcctgctggaccccgcggaaagcgtgctgaat
tacttcgagccctacctcgggcgcatcgagatcatggggggcgccaagaagatcgagcgt
gtttacttcgagatcagcgagtcgagccgcactcagtgggaaaagccccaggtgaaggag
tccaagcggcagttcatctttgacgtggtcaacgaaggcggcgagcaggagaagatggag
ctgttcgtgaacttctgcgaggacaccatctttgaaatgcagctggcatcccagatctcc
gagtcggacgcagctgacaggccagacgaggaggaggaagacgaagaagactctccttac
gcggcggaaactgagggcggccaggaggacgcgtccttcgagtccgcctcggcctttgcc
ctggcctgtgcctcgggcaagaggagcgtcgccggcttcctgaagagggcgaccctgagg
aacctccgcaagcagtggcgggcggtgaggaagatgacggtgaaggagctggtgagggtg
ttcctgtccttcttctgggcgctgttcgtgggcctgttccagttgttcttcgccgtcttg
gggggagtctttcagatcctctggaacacggtgtttggggggggcctggtagaaggggcc
aagaacatcagggtgaccaagatcctgggggacatgcctgacccaacccaattcggcatc
cacgacgacgctgtggaggctgagagggcagaagggaccgagccgggcatcgccacggac
ctggggcacttcttaaagggtgagaagggagatgcggatctcgtgtcagatccttttggg
ttgcaccccaagagagaaggcggcctaaagcatgggcccgaagcgggtctgggtgacctc
tctgagattatcggcaaggatgaacccccgacgctagagagcaccgtccggaagaaaagg
aaagcgcaggcagcagagatgaaagcagcacatgaatcagaaggaaaagtagaacctgag
aaggcagacatggaagatggagagaaggaggagacggccggagaggagcgagccaaggcc
ctgtgggcagaagcaacaaaaaagaagaagcggcggcgtggccagaaagttgagaagcct
gaagccttcatggctaatttcttcaaagggctggaagtctatcagaccaagctcctgcac
tacctggccaggaatttctacaacctgaggttcctcgctctgtttgtagccttcgccatc
aacttcatcctgctcttttacaaggtcactgaagaacctctggaagaggagacagaggac
gtggcgaacctgtggcattccttcaacgacgacgaagaggaagaagcgatggtgttcttt
gtcctgcaggagagcacggggtacatggcgccagcgctgcgggccctggctgtcgtccac
accatcatctccttggtctgtgtggtgggctactactgcctgaaggtccctttggtggta
ttcaaaagagaaaaagaaattgccaggaagctggagtttgatggcctgtatatcaccgaa
cagccatctgaagatgacatcaaggggcaatgggaccgcttggtaatcaacaccccatct
tttcctaacaactactgggacaaatttgtaaagagaaaggtgatcaacaagtacggcgat
ctctacggagcggaacgcattgctgaactccttggtttagacaaaaacgcccttgacttt
agcccggtggaagagaccaaagcagaggcggcctctctcgtgtcatggctaagttccatc
gacatgaagtaccatatctggaagctgggagttgtttttactgacaattccttcctctac
ttggcctggtacacaaccatgtccatcctgggccactacaacaacttcttttttgctgct
cacctgctggatatcgccatgggcttcaagacactgaggactattctgtcatctgtaact
cataacggcaaacagctggtcctgaccgtggggctcctggccgtggtggtttacctctac
accgtggtggccttcaacttcttccgcaagttctacaacaagagtgaggatgacgacgat
cccgacatgaagtgtgatgatatgatgacgtgttacctattccacatgtacgtgggagtg
agagctggaggaggcatcggcgatgagattgaagaccctgctggtgacccgtacgaaatg
taccgcattgtcttcgacatcaccttcttcttcttcgtcattgtcattttgctggccatc
attcaaggtcttattattgatgcttttggagagctaagagaccagcaggaacaagtacga
gaagatatggagactaaatgcttcatctgtgggattggcaatgactactttgacacgacc
ccccatggttttgaaacacatacgttgcaagagcacaacttagccaactacttattcttc
ctgatgtatttgattaacaaagatgaaacagagcacacgggtcaggaatcttatgtctgg
aagatgtaccaagaaaggtgttgggatttcttcccagctggtgactgctttcggaaacag
tacgaagatcagcttggataa

KEGG   Miniopterus natalensis: 107527206
Entry
107527206         CDS       T05883                                 

Definition
(RefSeq) ryanodine receptor 2-like
  KO
K04962  ryanodine receptor 2
Organism
mna  Miniopterus natalensis
Pathway
mna04020  Calcium signaling pathway
mna04024  cAMP signaling pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna04371  Apelin signaling pathway
mna04713  Circadian entrainment
mna04911  Insulin secretion
mna04921  Oxytocin signaling pathway
mna04972  Pancreatic secretion
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05410  Hypertrophic cardiomyopathy
mna05412  Arrhythmogenic right ventricular cardiomyopathy
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107527206
   04020 Calcium signaling pathway
    107527206
   04024 cAMP signaling pathway
    107527206
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107527206
   04921 Oxytocin signaling pathway
    107527206
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107527206
   04261 Adrenergic signaling in cardiomyocytes
    107527206
  09154 Digestive system
   04972 Pancreatic secretion
    107527206
  09159 Environmental adaptation
   04713 Circadian entrainment
    107527206
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    107527206
   05022 Pathways of neurodegeneration - multiple diseases
    107527206
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107527206
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107527206
   05414 Dilated cardiomyopathy
    107527206
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107527206
   04990 Domain-containing proteins not elsewhere classified [BR:mna04990]
    107527206
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Ryanodine receptor
   107527206
Domain-containing proteins not elsewhere classified [BR:mna04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   107527206
SSDB
Motif
Pfam: RYDR_ITPR RyR SPRY Ins145_P3_rec MIR
Other DBs
NCBI-GeneID: 107527206
NCBI-ProteinID: XP_016055370
LinkDB
Position
Unknown
AA seq 2468 aa
MYPCLLTSIAFCDHARVCQDDQVVLQCTAAAHKEPRKLCLAAEGFGNRLCFLESTSNSKN
VPPDLSICTFVLEQSLSVRALQEMLANTVEKSEGQVDVEKWKFMMKTAQGSGHRTLLYGH
AILLRHSYSGMYLCCLSTSRSSTDKLAFDVGLQEDTTGEACWWTIHPASKQRSEGEKVRV
GDDLILVSVSSERYLHLSYGSGGGSLHVDAAFQQTLWSVAPISSGSEAAQGYLIGGDVLR
LLHGHMDECLTVPSGEHGEEQRRTVHYEGGAVSVHARSLWRLETLRVAWSGSHIRWGQPF
RLRHVTTGKYLSLLEDKNLLLTDKEKADVKSTAFTFRSSKEKLDAGVRKEVDGMGTSEIK
YGDSVCYIQHVNTGLWLTYQAVDVKSVRMGAVQRKAIMHHEGHMDDGINLSRSQHEESRT
AGVIRSTVFLFNRFIRGLDALGRKAKAPPVDLPIESVSLSLQDLIGYLHPPAEHLEHEDK
QNRLRALKSRQNLFQEEGMISLVLQCVDRLHVYSSAAHFADVAGREAGESWKSILNSLYE
LLAALIRGNRKNCAQFSGSLDWLVSRLERLEASSGILEVLHCVLVESPEALNIIKEGHVR
SIISLLDKHGRNHKVLDVLCSLCVCHGVAVRSNQHLICDNLLPGRDLLLQTRLVNHVSSM
RPNIFLGVSEGSAQYKKWYYELMVDHAEPFVTAEATHLRVGWASTEGYSPYPGGGEEWGG
NGVGDDLFSYGFDGLHLWAGCIASTVSSPNQHLLRTEDVISCCLDLSAPSISFRINGQPV
QGMFENFNIDGLFFPVVSFSAGIKVRFLLGGRHGEFKFLPPLGYAPCFEAVLPKEKLKVE
HSREYKQERTYTRDLLGPTVPLTQAAFTPVPVDTTQIVLPPHLDRIREKLAENIHELWVM
NKIELGWQYGPVRDDNKRQHPCLVEFSKLPEQERNYNLQMSLETLKTLLALGCHVGILDD
HAEEKVKKMKLPKNYQLTSGYKPAPMDLSFIKLTPSQEAMVDKLAENAHNVWARDRIRQG
WTYGIQQDVKNRRNPRLVPYTLLDDRTKKSNKDSLREAVRTLLGYGYSLEAPDQDHAARA
EVCSSTGERFRIFRAEKTYAVKAGRWYFEFEAVTAGDMRVGWSRPGCQPDQELGSDEQAF
AFDGFKAQRWHQGNEHYGRSWQAGDVVGCMVDMTEHTMMFTLNGEILLDDSGSELAFKEF
DVGDGFIPVCSLGVAQVGRLNFGKDVSTLKYFTICGLQEGYEPFAVNTNRDITMWLSKRL
PQFLQVPSNHEHIEVTRIDGTVDSSPCLKVTQKSFGSQNSSTDIMFYRLSMPIECAEVFS
RTAAGGLPGAGLFGPKNDLEDYDADSDFEVLMKTAHGHLVPDRVDKDKEATKPEFNNHKD
YAQEKPSRLKQRFLLRKTKPDYSTSHSARLTEDVLADDRDDYDYLMQTSTYYYSVRIFPG
QEPANVWVGWITSDFHQYDTGFDLDRVRTVTVTLGDEKGKVHESIKRSNCYMVCAGESMS
PGQVRNNNGLEIGCVVDAASGLLTFTANGKELGTYYQVEPSTKLFPAVFAQATSPNVFQF
ELGRIKNVMPLSAGLFKSEHRNPVPQCPPRLHVQFLSHVLWSRMPNQFLKVDVSRVSERQ
GWLVQCVEPLQFMSLHIPEENRSVDILELTEQEELLRFHAHTLRLYSAVCALGNHRVAHA
LCSHVDEAQLLYAIQSKHMPGPLRAGFYDLLVDMHLGAYATARLMMNSEFIVPMTEETKG
IRLFPDARRQHGLPGIGLSTSLRPRMRFASPSFVSLSHDGYQDSPEFPLDTLKAKTMQML
TEAVREGGLRARDPVGGTTEFLFVPLIKLFYTLLTMGVFQGEDLKHILQLIEPRVFTEAA
PEAEHRAPPREPRADDSRPEGAHGDAAEGLLQMKLPEPVKLQMCLLLQYLCDCQVRHRIE
AIVAFSDGFVAKLQDNQRFRYNEVMQALNMSAALTARKTKEFRSPPQEQINMLLNFKDDK
SECPCPEEIRDQLLDFHEDLMAHCGIELDEDGSLDGSSDLTIRGRLLSLVEKVTYLKKKQ
ADKPVESASKQSSTLQQLISETMVRWAQESVIEDPELVRAMFVLLHRQYDGIGGLVRALP
KTYTINAVSVEDTISLLASLGQIRSLLSVRMGREEEKLMIRGLGDIMNNKVFYQHPNLMR
ALGMHETVMEVMVNVLSGGESKEITFPKMVANCCRFLCYFCRISRQNQKAMFDHLSYLLE
NSSVGLASPAMRGSTPLDVAAASVMDNNELALALREPDLEKVVRYLAGCGLQSCQMLVAK
GYPDIGWNPVEGERYLDFLRFAVFCNGESVEENANVVVRLLIRRPECFGPALRGEGGNGL
LAAMEEAIKIAEDPSRDGPSPTSGSSKTPDTEEEDTIHMGNAIMTFYAALIDLLGRCAPE
MHLIHAGKGEAIRIRSILRSLIPLGDLVGVISITFQMPTVAKGEVHSGGCCMTRIISARH
CPPCYTFL
NT seq 7407 nt   +upstreamnt  +downstreamnt
atgtatccatgtctcctcacctccattgccttctgcgaccatgccagggtctgccaggac
gaccaggtggtgctgcagtgcacggccgctgcccacaaggagccacggaaactctgcttg
gctgcggaaggattcggcaacaggctctgcttcctggagtccacctcaaattccaagaat
gttcccccagacctctccatctgcacctttgtgctggaacagtccctctctgtccgggcc
ctacaggagatgctggcgaacacggtggagaagtcagaagggcaggttgatgtggaaaaa
tggaaattcatgatgaagactgctcaaggcagtggtcaccggacgctcctctacggacac
gccatactgctgcgccactcctacagcggcatgtacctgtgctgcctgtccacctcccgg
tcttcaacggataaactggccttcgacgtcggcttgcaagaggacaccacaggcgaggct
tgctggtggaccatccaccccgcctccaagcagcggtccgagggagagaaagtgcgcgtg
ggcgatgacctcatcttagtgagtgtgtcctccgagaggtacttgcacctgtcctacggc
agcggcggtggcagcctgcacgtggacgccgcgttccagcagactctctggagcgtcgcc
cccatcagctcaggaagcgaagcggcccaagggtacctgatcggcggtgatgtcctgagg
ttgctgcacggacacatggacgagtgcctcaccgtcccctccggagagcatggggaggag
cagcggagaactgttcattacgagggcggtgccgtttcggttcacgcgaggtccctgtgg
aggctggagacgctgagagttgcgtggagcgggagccacattcggtgggggcagcccttc
cggctgcgccacgtcaccacggggaagtacctgagcctcctggaagacaagaacctcctg
ctcaccgacaaagagaaagccgacgtgaagtcaacggcctttaccttccggtcgtccaag
gaaaaactggatgcaggggtgagaaaagaagtggatggcatgggaacctccgagataaag
tacggagactcggtctgctacatacagcacgtgaacacgggcctgtggctgacgtaccag
gccgtggacgtgaagtccgtgaggatgggagccgtccagcgtaaggccattatgcatcac
gaaggccacatggatgacggcataaacttatccagatcgcagcacgaggagtcccggacg
gcgggggtcatccgcagcacagtcttccttttcaatagatttataaggggcttggacgct
ctgggcaggaaagcgaaggcgcccccagtggacctgcccatcgagtcggtcagcctgagc
ctgcaggacctgataggctacctgcacccgccggccgagcacctggagcacgaggacaag
cagaaccggctgcgggccctgaagagccggcagaacctcttccaggaggaggggatgatc
agcctggtgctccagtgtgtggaccggctgcacgtgtacagcagtgctgcccactttgcg
gatgtggctggtagagaggccggggagtcctggaagtcgatcctgaattctctgtacgag
ctgctggccgctctaattagaggaaatcgtaaaaactgcgcccagttttctggctccctc
gactggctggtcagccgactggagcggctggaagcctcttctggtattcttgaggttctg
cactgtgtgctggtggaaagcccggaagctctaaacatcatcaaagaagggcacgtcagg
tccatcatttcccttctcgacaagcacgggcggaaccacaaggtcctggacgtcctgtgt
tctctctgcgtctgccacggggtggcagtccgttccaaccagcatctcatctgtgacaac
cttctgccaggaagggacttgctcctgcagacgcgcctggtgaaccacgtcagcagcatg
agacccaatattttcctgggcgtcagtgaagggtctgcccagtataagaagtggtactac
gaactgatggtggaccacgccgagcccttcgtgaccgcggaggcgactcacctgcgcgtg
ggctgggcgtccacagaagggtactcgccctaccctggtgggggcgaggagtggggcggg
aacggcgttggagacgacctcttttcttacggattcgatggtctgcacctctgggcaggg
tgcatcgccagcactgtcagctccccaaaccagcacctgctgaggactgaggacgtcatc
agctgctgtttagatctgagcgccccaagcatctctttccgaattaacggacagcctgtc
caggggatgttcgagaatttcaacatcgacggcctcttctttcccgttgtcagtttctct
gcgggaataaaggtgcgcttcctgcttggggggagacatggagagtttaaattccttcct
cccttgggctatgctccttgctttgaagctgtgctgccaaaagaaaagttgaaagtggaa
cacagccgagagtacaaacaagaaaggacgtacacccgggacctcctgggccccacggtg
cccctgacgcaggctgccttcacgccggtccccgtggacaccacccagatcgtgctgccg
ccccacctggacaggataagagaaaagctcgcagagaacatccatgagctctgggttatg
aataaaatcgaacttggctggcagtatggcccggtccgagacgacaacaagaggcagcac
ccgtgcctggtggagttctccaagctgccggagcaggagcgcaactacaatttgcagatg
tcgcttgagaccctgaagacgttgttggcgttaggatgtcacgtgggcatattagacgac
catgctgaggagaaggtgaagaagatgaagctacccaagaattaccagctgacaagtgga
tacaagccggccccgatggacctgagctttatcaaactcacgccctctcaggaagcgatg
gtagacaagttggcagaaaatgctcacaacgtgtgggcccgggaccggatccggcagggc
tggacctacggcatccagcaggatgtgaagaacaggagaaaccctcgcctggttccgtac
acccttctcgacgaccgaaccaagaagtccaacaaggacagcctccgagaggctgtgcgc
acgctgctgggctacggctacagcctggaggcgccggaccaggaccacgctgcccgagct
gaggtgtgcagcagcaccggggaacggttccgaatcttccgggccgagaagacctatgct
gtgaaggcaggaaggtggtactttgaattcgaggctgtcactgctggggacatgagagtt
ggctggagcaggccaggctgtcagcctgatcaggagctgggctctgatgaacaggccttt
gcttttgatggcttcaaggcgcagcggtggcaccagggcaatgagcactatgggcgctcg
tggcaagctggcgacgtcgtggggtgcatggtggacatgaccgaacacaccatgatgttc
acgctgaatggcgaaatccttctcgatgactcgggttccgagctggccttcaaggaattt
gacgtgggcgacggattcatacctgtgtgcagccttggggtggctcaggtggggaggctg
aactttggaaaggatgtgagcaccttgaagtacttcaccatctgcggcttacaagagggc
tatgagccattcgccgtcaacacaaacagggacatcaccatgtggctaagcaaacggctt
cctcagtttctccaagttccatcaaaccatgaacatattgaggtgaccagaatagatggc
accgtggacagctccccgtgcttgaaggtcactcagaagtccttcggctcccagaacagc
agcacagacatcatgttctaccggctgagcatgcccatcgagtgtgccgaggtcttctcc
aggaccgcggctggggggctcccaggtgccggcctctttgggcccaagaacgacctggag
gattacgatgctgattctgacttcgaggttctcatgaagacagctcacggccatctggtg
cccgaccgagtcgacaaagacaaggaagctacgaaaccagagtttaataaccacaaagat
tacgcgcaggaaaagccctctcgtctgaaacaaagattcttgcttagaaaaacgaagcca
gattatagcacaagccattccgcgaggctcaccgaggatgtcctcgcggacgatcgggac
gactacgactacttgatgcagacgtccacgtactattactcagtgaggatcttccccgga
caagagcccgccaacgtctgggtgggctggattacgtccgatttccaccagtacgacaca
ggcttcgacctggacagagtccgcacagtcaccgtcactctaggagatgaaaaagggaag
gtgcacgaaagcatcaaacgcagcaactgctacatggtttgtgcgggcgagagcatgagc
cccgggcaggtgcgcaacaacaacgggctggagatcggctgcgtggtggacgccgccagc
gggctgctcaccttcacggccaacggcaaggagctgggcacgtactaccaggtggagcca
agcaccaaattatttcctgccgtttttgcacaagctacaagccccaatgttttccagttt
gaactgggaagaattaagaatgtgatgcctctctcggccggactgttcaagagtgagcac
aggaaccctgtgcctcagtgtcctccacgcctgcatgtgcagttcctatcgcacgtccta
tggagcaggatgcccaaccagttcctgaaggtggacgtgtcacgggtcagcgagcgccag
ggctggctggtgcagtgcgtggagcccctgcagttcatgtccctgcacatccccgaggag
aacaggtccgtggacatcctggagctgacggagcaggaggagctgctgcgcttccacgcg
cacacgctgcgcctctactcggccgtgtgcgcgctgggcaaccaccgcgtggcgcacgcg
ctctgcagccacgtggacgaggcgcagctgctctacgccatccagagcaagcacatgccc
ggcccgctgcgcgccggcttctacgacctgctcgtggacatgcacctgggcgcctacgcc
accgcgcggctcatgatgaacagcgagttcatcgtgcccatgacggaggagaccaagggc
atcaggctcttccccgacgcgcgcaggcagcacgggctgcccggcatcggcctcagcacc
tcgctgcgcccgcgcatgcgcttcgcctcgcccagcttcgtgagcctcagccacgacggc
taccaggacagccccgagttccccctggacacgctcaaggccaagaccatgcagatgctg
acggaggcggtgcgggagggcggcctgcgcgcgcgcgacccggtcgggggcaccaccgag
ttcctcttcgtgccgctcatcaagctcttctacacgctgctcaccatgggcgtcttccag
ggcgaggacctgaagcacatcctgcagctgattgagccccgggtgttcacagaggccgcc
ccggaggcggagcaccgggcgccacccagagagccccgcgcggatgactccaggccggag
ggtgcacatggggacgcggccgagggactgctgcagatgaaactgcccgagccagtgaag
ctccagatgtgtctgctccttcagtacctctgcgactgccaggtccgacaccggatcgaa
gccatcgtggccttttcagatggctttgttgctaagctgcaggacaaccagcgcttccgc
tataatgaggtcatgcaggccctaaacatgtcagccgcactcacagccaggaagaccaag
gagttcaggtcgcccccgcaagagcagatcaatatgcttctcaattttaaggatgacaaa
agcgagtgtccgtgtccagaggaaattcgagaccaactcttggattttcacgaagatctg
atggcacactgtggaattgagctggatgaagatgggtctctggatggaagcagtgaccta
acaattagagggcgcctgctgtccctggtggaaaaggtgacatacctgaagaagaaacag
gctgacaagccagtggagagcgcctccaagcagtcctccacacttcagcagctgatttcc
gagacgatggtgcggtgggctcaggagtccgtcatcgaggaccccgagctggtgcgggcc
atgttcgtgctgctgcaccggcagtacgacggcatcgggggcctggtgcgggctctgccg
aagacctacaccatcaacgccgtctccgtggaggacaccatcagcctgctggcctccctc
gggcagatccgctctctgctgagcgtcaggatgggcagagaggaggagaagctcatgatt
cgtggattaggggacatcatgaataataaagtgttttaccagcacccgaacctcatgagg
gcactggggatgcacgagacagtgatggaggtcatggtgaacgtgctcagcggtggggag
tccaaggagatcactttccccaagatggtggccaactgttgccgttttctctgttacttc
tgtcgtataagtcggcagaatcaaaaagctatgtttgaccatctcagttatttattggaa
aacagcagtgttggtctagcctcgccagctatgagaggctcgacgccgctggatgtggca
gcagcctcggtgatggacaacaacgaactcgccttagctctgcgggagccagatctggaa
aaggttgttcgatatttggctggctgtggactgcagagctgccagatgctggtggccaag
gggtacccagacatcgggtggaacccagtggaaggggagagatatctcgactttctccga
tttgctgtcttctgtaatggggagagcgtggaggagaatgccaacgtggtggtgcggctg
ctcatccgcaggcccgagtgcttcgggcccgcgctgcggggcgagggcggcaacgggctc
ctcgcagccatggaggaggccatcaagatagccgaggaccccagtcgggacggcccctcc
ccgaccagcggctccagcaagacccctgacacggaggaggaggacaccatccacatgggg
aacgccatcatgaccttctacgccgcgctcatcgacctgctggggcgctgcgcccccgag
atgcacctgattcatgctgggaagggagaagccatcaggatcaggtcaattttgagatcg
ctcattcccctgggagacctggtgggcgtgatcagcatcaccttccagatgcccacggtc
gccaaaggtgaggtgcattcagggggatgctgcatgacacggattatcagtgctcggcat
tgccctccctgctacacgtttctttaa

KEGG   Miniopterus natalensis: 107532181
Entry
107532181         CDS       T05883                                 

Gene name
RYR1
Definition
(RefSeq) ryanodine receptor 1
  KO
K04961  ryanodine receptor 1
Organism
mna  Miniopterus natalensis
Pathway
mna04020  Calcium signaling pathway
mna04371  Apelin signaling pathway
mna04713  Circadian entrainment
mna04730  Long-term depression
mna04921  Oxytocin signaling pathway
mna05017  Spinocerebellar ataxia
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107532181 (RYR1)
   04020 Calcium signaling pathway
    107532181 (RYR1)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107532181 (RYR1)
  09156 Nervous system
   04730 Long-term depression
    107532181 (RYR1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107532181 (RYR1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    107532181 (RYR1)
   05020 Prion disease
    107532181 (RYR1)
   05022 Pathways of neurodegeneration - multiple diseases
    107532181 (RYR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107532181 (RYR1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107532181 (RYR1)
   04040 Ion channels [BR:mna04040]
    107532181 (RYR1)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107532181 (RYR1)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107532181 (RYR1)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Ryanodine receptor
   107532181 (RYR1)
SSDB
Motif
Pfam: RyR RYDR_ITPR RR_TM4-6 SPRY Ins145_P3_rec MIR RIH_assoc Ion_trans EF-hand_7 DUF1840
Other DBs
NCBI-GeneID: 107532181
NCBI-ProteinID: XP_016061941
LinkDB
Position
Unknown
AA seq 4762 aa
MGDGGEGEDEVQFLRTDDEVVLQCSATVLKEQLKLCLAAEGFGNRLCFLEPTSNAQNVPP
DLAICCFVLEQSLSVRALQEMLANTVEAGVESSQGGGHRTLLYGHAILLRHAHSSMYLSC
LTTSRSMTDKLAFDVGLQEDATGEACWWTMHPASKQRSEGEKVRVGDDLILVSVSSERYL
HLSTASGELQVDASFMQTLWNMNPISSGCEEGFVTGGHVLRLFHGHMDECLTISPADSDD
QRRLVHYEGGAVCTHARSLWRLEPLRISWSGSHLRWGQPLRIRHVTTGRYLALTEDQGLV
VVDASKAHTKATSFCFRISKEKLDVAPKRDVEGMGPPEIKYGESLCFVQHVASGLWLTYA
APDPKALRLGVLKKKAMLHQEGHMDDALSLTRCQQEESQAARMIYSTAGLYNQFIKTQGM
LSLVLNCIDRLNVYTTAAHFAEFAGEEAAESWKEIVNLLYELLASLIRGNRTNCALFSTN
LDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVLDVL
CSLCVCNGVAVRSNQDLITENLLPGRELLLQTNLINYVTSIRPNIFVGRAEGSTQYGKWY
FEVMVDEVTPFLTAQATHLRVGWALTEGYSPYPGGGEGWGGNGVGDDLYSYGFDGLHLWT
GHVARPVTSPGQHLLAAEDVVSCCLDLSVPSISFRINGCPVQGVFEAFNLDGLFFPVVSF
SAGVKVRFLLGGRHGEFKFLPPPGYAPCHEAVLPRERLHLEPIKEYRREGPRGPHLVGPS
RCLSHTDFVPCPVDTVQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDDNKRL
HPCLVNFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTYMMSN
GYKPAPLDLSHVRLTPAQTTLVDRLAENGHNVWARDRVAQGWSYSAVQDIPARRNPRLVP
YRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSLVESQSRWDRVRIFRAEKSYVV
QSGRWYFEFEAVTTGEMRVGWARPELRPDTELGADELAYVFNGHRGQRWHLGSEPFGRPW
QSGDVVGCMIDLTENTIIFTLNGEILMSDSGSETAFRDIEIGDGFLPVCSLGPGQVGHLN
LGQDVSSLRFFAICGLQEGFEPFAINMQRPVTTWFSKSLPQFEAVPLEHPHYEVARVDGT
VDTPPCLRLTHRTWGSQNSLVEMLFLRLSLPVQFHQHFRCTAGATPLASPGLQPPAEDEA
WAAEPDTDYENLRRSAGRWGEAEGGKEGTAKEGAPGGTLQAAAEAQPVRAENEKDATTEK
NKKRGFLFKAKKAAMMTQPPATPALPRLPREVVPADNRDDPEIILNTTTYYYSVRVFAGQ
EPSCVWVGWVTPDYHQHDMNFDLSKVRAVTVTMGDEQGNVHSSLKCSNCYMVWGGDFVSP
GQQGRISHTDLVIGCLVDLATGLMTFTANGKESNTFFQVEPNTKLFPAVFVLPTHQNVIQ
FELGKQKNIMPLSAAMFLSERKNPAPQCPPRLEVQMLMPISWSRMPNHFLQVDTRRAGER
LGWAVECQEPLIMMALHIPEENRCMDILELSERLNLQRFHSHTLRLYRAVCALGNNRVAH
ALCSHVDQAQLLHALEDAHLPGPLRAGYYDLLISIHLESACRSRRSMLSEYIVPLTAETR
AITLFPPGKSEDNGPRRHGLPGVGVTTSLRPPHHFSPPCFVAALPTAGIAEAPARLSPSI
PLEALRDKALRMLGEAVRDGGQHARDPVGGSVEFQFVPVLKLVSTLLVMGVFGDEDVKQI
LKMIEPEVFTEEEEEEEEEDEEEKEEDEEEEAQEEEEEEEEEEEAAEGEKEGLEEGLLQM
KLPESVKLQMCHLLEYFCDQELQHRVESLAAFAERYVDKLQSNQRDRYGLLMKAFTMSAA
ETARRTREFRSPPQEQINMLVHFKDGQEEEDCPLPEEIRQDLLKFHEDLLAHCGIQLEGK
EEEPEEEVTLSSRLRSLLEKVRLVKKEEEKPEEELPAEESKPKSLQELVSHTVVRWAQED
FVQSPELVRAMFSLLHRQYDGLGELLRALPRAYTISPSSVVDTMNLLECLGQIRSLLIVQ
MGPQEENLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGESKEIRFPKMV
TSCCRFLCYFCRISRQNQRSMFDHLSYLLENSGIGLGMQGSTPLDVAAASVIDNNELALA
LQEQDLEKVVSYLAGCGLQSCPMLLAKGYPDIGWNPCGGERYLDFLRFAVFVNGESVEEN
ANVVVRLLIRKPECFGPALRGEGGSGLLAAIEEAIRISEDPARDGPGVRRDRRREHFGEE
PPEENRVHLGHAIMSFYAALIDLLGRCAPEMHLIQAGKGEALRIRAILRSLVPLDDLVGI
ISLPLQIPTLGKDGALVQPKMSASFVPDHKASMVLFLDRVYGIENQDFLLHVLDVGFLPD
MRAAASLDTATFSTTEMALALNRYLCLAVLPLITKCAPLFAGTEHRAIMVDSMLHTVYRL
SRGRSLTKAQRDVIEDCLMALCRYIRPSMLQHLLRRLVFDVPILNEFAKMPLKLLTNHYE
RCWKYYCLPTGWANFGITSEEELHLTRKLFWGIFDSLAHKKYDPELYRIAMPCLCAIAGA
LPPDYVDASYSSKAEKKATVDAEGNFDPRPVETLNVIIPEKLDSFINKFAEYTHEKWAFD
KIQNNWSYGENADEELKTHPMLRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTIEKAREG
EEEKTEKKKTRKISQSAQTYDPREGYNPQPPDLSGVTLSRELQAMAEQLAENYHNTWGRK
KKLELEAKGGGTHPLLVPYDTLTAKEKARDREKAQELLKFLQMNGYAVTRGLKDMELDTS
SIEKRFAFGFLQQLLRWMDISQEFIAHLEAVVSSGRVEKSPHEQEIKFFAKILLPLINQY
FTNHCLYFLSTPAKVLGSGGHASNKEKEMITSLFCKLAALVRHRVSLFGTDAPAVVNCLH
ILARSLDARTVMKSGPEIVKAGLRSFFESASEDIEKMVENLRLGKVSQARTQVKGVGQNL
TYTTVALLPVLTTLFQHIAQHQFGDDVILDDVQVSCYRTLCSIYSLGTTRNSYVEKLRPA
LGECLARLAAAMPVAFLEPQLNEYNAYSVYTTKSPRERAILGLPNSVEEMCPDIPVLERL
MADIGGLAESGARYTEMPHVIEITLPMLCSYLPRWWERGPEVPPPALPAGVPPPCTAVTS
DHLNSLLGNILRIIVNNLGIDEASWMKRLAVFAQPIVSRARPELLHSHFIPTIGRLRKRA
GKVVAEEEQLRLEAKAEAEEGELLVRDEFSVLCRDLYALYPLLIRYVDNNRAHWLTEPNP
SAEELFRMVGEIFIYWCKSHNFKREEQNFVVQNEINNMSFLTADNKSKMAKSGGSDQERT
KKKRRGDRYSIQTSLIVATLKKMLPIGLNMCAPTDQDLIALAKTRYALKDTDEEVREFLH
NNLHLQGKVEGSPSLRWQMALYRGLPGREEDADDPEKIVRRVQEVSAVLYHLEQVEHPYK
SKKAVWHKLLSKQRRRAVVACFRMTPLYNLPTHRACNMFLERYKATWILTEDHSFEDRMI
DDLSKAGEQEEEEEEVEEKKPDPLHQLVLHFSRTALTEKSKLDEDYLYMAYADIMAKSCH
LEEGGENGEAEEEVEVSFEEKEMEKQRLLYQQARLHNRGAAEMVLQMISACKGETGAMVS
STLKLGISILNGGNADVQQKMLDYLKDKKEVGFFQSIQALMQTCSVLDLNAFERQNKAEG
LGMVNEDGTVINRQNGEKVMADDEFTQDLFRFLQLLCEGHNNDFQNYLRTQTGNTTTINI
IICTVDYLLRLQESISDFYWYYSGKDVIEEQGKRNFSKAMSVAKQVFNSLTEYIQGPCTG
NQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIELLKELLDLQKDMVVMLLSLLEGNV
VNGMIARQMVDMLVESSSNVEMILKFFDMFLKLKDIVGSEAFQDYVTDPRGLISKKDFQK
AMDSQKQFSGPEIQFLLSCSEADENEMINCEEFANRFQEPAREIGFNVAVLLTDLSEHVP
HDPRLRTFLELADSILEYFRPYLGRIEIMGASRRIERIYFEISETNRTQWEMPQVKESKR
QFIFDVVNEGGESEKMELFVSFCEDTIFEMQIAAQISEPEGEPEEDEDDGAAEGSPILKR
KLGVDGEEEELPPEPEPEPEPEPEKADAENGEKEEVPELPPEPPKKTAPPPPQPKKETRG
GGLEFWGELEVQRVKFLNYLSRNFYTLRFLALFLAFAINFILLFYKVSDSPPGEDDLEGS
AAGDLAGTGSGGGSGWGSGAGEEAEDDEDENMVYYFLEESTGYMEPALRCLSLLHTLVAF
LCIIGYNCLKVPLVIFKREKELARKLEFDGLYITEQPEDDDVKGQWDRLVLNTPSFPSNY
WDKFVKRKVLDKHGDIYGRERIAELLGMDLASLEITVHHERKPEPPPGLLTWLMSIDIKY
QIWKFGVIFTDNSFLYLGWYMVMSLLGHYNNFFFAAHLLDIAMGVKTLRTILSSVTHNGK
QLVMTVGLLAVVVYLYTVVAFNFFRKFYNKSEDEDEPDMKCDDMMTCYLFHMYVGVRAGG
GIGDEIEDPAGDEYELYRVVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDME
TKCFICGIGSDYFDTTPHGFETHTLEEHNLANYMFFLMYLINKDETEHTGQESYVWKMYQ
ERCWDFFPAGDCFRKQYEDQLN
NT seq 14289 nt   +upstreamnt  +downstreamnt
atgggtgacggaggagagggcgaggatgaggttcagtttctgcggacggatgatgaagta
gtcctacagtgcagtgccacggtgctcaaggagcagctcaagctctgcctggcagccgaa
ggctttggcaaccgcctctgcttcctggagcccaccagcaatgcccagaatgtgcccccc
gatctggccatctgttgctttgtcctggagcagtcactatccgtccgagccctgcaggag
atgctggccaacactgtggaagctggagtggagtcatcccagggtgggggacacaggaca
ctcctgtatggccatgccatcctgctccggcatgcacacagcagcatgtacctgagctgt
ctcactacctcccgctccatgacggacaagctggcctttgacgtgggactgcaggaagat
gcaacaggagaggcctgttggtggacaatgcaccctgcctccaagcagagatctgaagga
gagaaggtccgagttggggatgacctcatcctcgttagtgtctcctctgagcgctatctg
cacctgtcaacggccagtggggagctccaagttgatgcctccttcatgcagacattgtgg
aacatgaaccccatctcctctggctgtgaagagggctttgtgacgggaggccatgtcctc
cgcctctttcacggacacatggatgagtgcctgaccatttcccctgctgacagtgatgac
cagcgcagacttgtccattatgagggtggagctgtgtgcacccacgcccgctccctctgg
agactggagcctctgagaatcagctggagtgggagccaccttcgctggggtcagccgctt
cgcatccgccatgtcaccacggggcggtacctggcactcaccgaggaccagggtctggtg
gtggttgatgccagcaaggcgcacaccaaggccacctccttctgcttccgcatctccaag
gagaagctggatgtggcccccaagcgggacgtggaaggcatgggcccccctgagatcaag
tatggagagtcactgtgctttgtgcagcatgtggcctcaggcctgtggctcacctatgca
gccccggaccccaaagctctgcggctcggggtgctgaagaaaaaggccatgctgcaccag
gaaggccacatggatgacgcgctgtcactgacccgctgccagcaggaggagtcccaggct
gcccgcatgatctacagcacggctggcctctataaccagttcatcaagacacaggggatg
ctctccctggtcctgaattgcattgaccgcctaaatgtctacaccactgctgctcacttt
gctgaatttgccggggaggaggcagccgagtcttggaaagagattgtgaacctgctctat
gaactcctggcctctctgatccgtggcaatcgtaccaactgtgccctcttctccaccaac
ttggattggttggtcagcaagctggatcggctggaagcctcatctggaatcctagaggtg
ctgtactgtgtcctgattgagagtcccgaggtcctgaacatcatccaagagaaccacatc
aagtccatcatctccctcctggacaagcatgggaggaatcacaaggtgctggatgtgttg
tgttccctgtgtgtgtgtaatggcgtggccgtgcgctccaatcaagatctcataaccgag
aacttgctccctggccgtgagcttctgctgcagacaaacctcatcaactatgtcaccagc
atccgccccaacatctttgtgggccgagcagagggctccacacagtatgggaaatggtac
tttgaggtgatggtggatgaagtgactccattcctgacagctcaggccacccacctgcgg
gtgggctgggccctcactgagggctacagcccctaccctgggggcggcgagggctggggc
ggtaacggcgttggcgacgacctctattcctatggctttgatgggctgcatctctggaca
ggacacgtggcacgcccagtgacttccccaggacagcacctcctggccgcggaggacgtg
gtcagctgctgcctggacctcagcgttccatccatctccttccgcatcaatggctgcccc
gtgcagggcgtcttcgaggccttcaacctcgatgggctcttcttccctgtcgtcagcttc
tcagctggtgtaaaggtgcggttcctccttggtggccgacatggcgaattcaagttcctc
ccgccacctggctacgccccatgccatgaggctgtgctcccaagagagcgactccacctg
gaacccatcaaggagtatcggcgggagggaccccgaggaccccacttggtgggcccaagc
cgctgcctctcacacaccgactttgtgccctgccccgtggacactgtccagattgtcctg
ccaccccatctggagcgtatccgggagaagctggcagagaacatccatgaactttgggcg
ctgactcgcattgagcagggctggacctatggcccggttcgggatgacaacaagaggctg
cacccgtgtcttgtgaacttccacagccttccagagccagagaggaactacaacctgcag
atgtcgggggagacacttaagactctgctggcactgggctgccatgtgggcatggcagac
gagaaggcagaggacaacttgaagaagacaaaactccccaagacgtatatgatgagcaac
gggtacaagccagcgccactagacctgagccatgtgcggctgactcctgcacagaccaca
ttggtggaccggctggcggagaacgggcataatgtgtgggcccgagaccgtgtggcccag
ggctggagctacagtgctgtgcaggacatccctgcacgccgaaaccctcgcctggttccc
taccgcctgttggatgaggccaccaagcgcagcaaccgggacagcctctgtcaggctgtg
cgtaccctgctgggctatggctacaacattgagccacctgaccaggagcccagtctggtg
gagagccagtcccgttgggatcgggtgcgcatcttccgggcagagaaatcctatgtggtg
cagagtggccgctggtacttcgagtttgaggcagttaccacgggcgagatgcgagtgggc
tgggccaggcctgagctgcggcctgacacagagttgggagctgatgagctggcctatgtc
ttcaacgggcaccgcggccagcgctggcacttgggcagtgagccatttgggcgcccctgg
cagtcgggcgatgttgtgggctgcatgatcgacctcacagagaacaccattatcttcacc
cttaatggcgagatcctcatgtcggattcaggttctgagacggccttccgggacattgag
attggcgatggcttcctgcccgtctgcagcttaggacccggccaggtgggccacctgaac
ctgggccaggatgtgagttccctgcggttcttcgccatctgcggtctccaggagggcttt
gagccatttgccatcaacatgcagcgcccggtcaccacctggtttagcaaaagccttccc
caatttgaggccgtgccccttgagcatccccactatgaggtggcccgtgtagatggcact
gtggatacgcccccctgcctgcgcctcactcaccgcacatggggctcccagaacagtctg
gtggagatgctctttcttcggctgagccttcctgtccagttccaccagcacttccgctgc
actgcgggggccacccctctggcatcccctggcctgcagccccctgccgaggatgaggcc
tgggcagcggagcctgacaccgactatgaaaacctgcgccgctcagcggggcgctggggc
gaggctgaggggggcaaagagggaactgccaaggagggggcacccgggggcaccctccag
gctgcagcggaggcccagcctgtccgggccgaaaatgagaaggatgctaccacagagaaa
aacaagaagagagggttcttattcaaggccaagaaggccgccatgatgacccaaccacca
gccactcccgctctgccccggctccctcgagaggtggtgcccgccgataaccgtgatgac
cctgagatcatcctcaacaccaccacgtactattactccgtgagggtcttcgctggccag
gaacccagctgcgtatgggtgggctgggtcacccctgactaccatcagcacgacatgaac
tttgacctcagcaaggtccgggcagtgacagtcaccatgggggatgaacaaggcaacgtc
cacagcagcctcaagtgcagcaactgctacatggtgtggggcggggacttcgtgagtccc
gggcagcagggccggatcagccacacagaccttgtcattggctgcctggtggacttggcc
acaggcctaatgacctttacagccaatggcaaagagagcaacacctttttccaggtggaa
cccaacacgaagctctttcctgctgtctttgtcctgcccacccatcagaatgtcatccag
tttgagctggggaagcagaagaacatcatgccgctgtcagctgccatgttcctgagtgag
cgcaagaacccggccccgcagtgcccaccacggcttgaggtgcagatgctgatgcccatc
tcgtggagccgcatgcccaaccacttcctgcaggtggacacgcgacgggctggcgagcgg
ctgggctgggccgtggagtgccaggagccactaatcatgatggcactgcacatccccgag
gagaaccggtgcatggacatcttggagctgtccgagcgcctgaacctgcagcgcttccac
tcccacaccctccgcctctaccgtgcagtgtgcgccctgggcaacaaccgtgtggcacat
gctctgtgcagccacgtggaccaggcgcaactgctgcacgccctggaggatgcacacctg
cccgggcccctgcgtgctggctactacgacctcctcataagcatccacctggaaagtgcc
tgccgcagccgccgctctatgctctctgagtacatcgtgcccctcacggctgagacccgc
gccatcaccctcttcccacctggaaaaagcgaggataatggtccccgccggcacggcctg
cctggcgttggcgtcaccacctcccttcggcctccacaccatttctcacctccctgtttc
gtggctgccctgccaactgctgggatagcagaagccccagcccgcctcagccccagcatc
cctctggaggccctgcgggacaaagcactgagaatgctgggggaagcagtccgagatggt
gggcagcatgcacgtgaccctgttgggggctctgtggagttccagtttgtccctgtgctc
aagcttgtgtccaccctgctggtgatgggcgtctttggcgatgaggatgtgaaacagatt
ctgaagatgattgagcctgaagtattcactgaggaggaggaagaggaggaggaggaagat
gaggaggagaaggaggaggatgaggaggaggaggcccaagaggaggaggaggaggaggag
gaggaggaggaggcagcagaaggcgagaaagaaggcttggaggaggggcttctccagatg
aagctgcctgagtctgtgaagttgcagatgtgccacctgctggagtatttctgtgaccaa
gagctgcagcaccgggtggagtccctggcggcctttgcagagcgctatgtggacaagctc
cagtccaaccagcgggaccgttacggcctcctcatgaaagccttcaccatgtctgcagct
gagactgcccggcgtacccgcgagttccgctccccaccccaggagcagatcaacatgcta
gtgcacttcaaagatggtcaggaagaggaagattgtcctctccctgaagagattcgacag
gatttgctcaaatttcatgaagacctactggcacattgtggaattcagctggaggggaag
gaggaggaaccagaggaagaggtcaccctgagcagccgcctgaggagcctgttggagaaa
gtgcggctggtgaagaaggaggaggagaaacctgaggaggagctgcccgctgaggagagc
aaacccaagtcactgcaggagctggtgtctcacacagtggtgcgctgggcccaggaggac
ttcgtgcagagccctgagctggtccgggccatgttcagcctcttgcaccggcagtacgac
gggcttggggagctgctgcgcgccctgccccgggcgtacaccatctcgccgtcctctgtg
gtggacaccatgaacctgcttgagtgcctcggccagatccgctcgctgctcattgtgcag
atgggtccccaggaggagaacctcatgatccagagcattgggaacatcatgaacaacaaa
gttttctaccaacacccgaacctgatgagggcactgggcatgcacgagacggtcatggag
gtcatggtaaatgtcctcggcggcggtgaatccaaggagatccgcttccccaagatggtg
acaagctgctgccgcttcctctgttacttctgccgcattagccggcagaaccagcgctcc
atgtttgaccacctgagctacctgcttgagaacagcggcattggcctgggcatgcagggc
tccacacccctggatgtggcagctgcctctgtcattgacaacaatgagctggccttggcg
ttgcaggagcaggacctggagaaggtggtgtcctacctggctggctgtggcctccaaagt
tgtcccatgctcctggccaaaggatacccagacatcggctggaacccctgcggtggcgag
cgctacctggacttcctgcgcttcgctgtcttcgtcaatggtgagagcgtggaggagaac
gccaacgtggtggtgcggctgctcatccgcaagcccgagtgctttgggccagccctgagg
ggtgagggcggctcgggactgctggccgccatcgaagaggccatccgcatctccgaggac
cctgcgagggacggcccgggtgtccgtagggaccggcggcgtgagcactttggggaggag
ccccccgaggaaaaccgggtgcacctgggacacgccatcatgtccttctacgctgccttg
attgatctgcttggacgctgtgcacctgagatgcatctaatccaagctggcaagggtgag
gccctgcggatccgtgccatcctgcgctccctcgtgcccctggacgacctcgtgggcatc
atcagcctcccactgcagatccccaccctgggcaaagatggggctctggtacagccaaag
atgtcagcatcctttgtgcctgaccacaaggcatccatggtgctcttcttggaccgtgtg
tatggcatcgagaaccaggacttcctgctgcacgtgctggacgtgggattcttgcccgac
atgagggcagctgcctcgttggacacggccactttcagcaccacggagatggcgctggcg
ctgaaccggtacctgtgcctggcggtgctgccgctcatcaccaagtgcgcgccgctcttc
gcgggaaccgagcaccgcgccatcatggtggactcgatgcttcacacggtgtaccgcctg
tcccgcggccgctcgctcaccaaggcgcagcgcgacgtcatcgaggactgcctcatggcg
ctctgcaggtacatccgcccgtccatgctgcagcacctgctgcggcgcctggtgttcgac
gtgcccattctcaacgagttcgccaagatgcccctcaagctcctcaccaaccactatgag
cgctgttggaagtactactgcctgcccaccggctgggccaacttcggcatcacctcagag
gaagagctgcacctcacaaggaaactcttctggggcatctttgattcgctggcacacaag
aaatatgacccagagctgtaccgcatagctatgccttgtctgtgcgccatcgcaggggcc
ctgccccctgactacgtggatgcctcttactcgtccaaggctgagaaaaaggccacagtg
gatgctgaaggcaactttgatcctcggcctgtggagaccctcaatgtgatcatcccagag
aagctggactccttcattaacaagttcgcggagtacacacatgagaagtgggccttcgac
aagatccagaacaactggtcctatggggagaacgcagatgaggaactgaagacccacccc
atgctgaggccctataagaccttttcggagaaggacaaagagatctaccgctggcccatc
aaagagtccttaaaggccatgattgcctgggaatggaccatagagaaggccagggagggt
gaggaggagaagacggagaagaaaaaaacgcggaagatctcccaaagtgctcagacctat
gatccaagagaaggctacaacccccaaccgcccgacctcagcggagttaccctgtcccgg
gagctgcaggccatggccgaacagctggcagaaaattaccacaacacatgggggcgaaag
aagaagctggagctggaggccaagggtggtgggacccaccccctgctggttccctacgac
acgctcactgccaaggagaaggcacgagatcgagagaaggcccaggagctgctgaagttc
ctgcagatgaacggctatgcggtcaccaggggccttaaggacatggagctggatacatct
tccattgagaaacggttcgcctttggcttcctgcagcagttgctgcgctggatggacatt
tcccaggagtttatcgcccacctggaggctgtggtcagcagtggacgagtagaaaagtcc
cctcatgaacaggagattaaattctttgccaagatcctgctccctttgatcaaccagtac
ttcaccaaccactgcctgtatttcttgtccacaccagccaaagtgctgggcagtggtggc
cacgcctccaataaagagaaggaaatgatcaccagcctcttctgcaagcttgccgctctt
gtccgtcaccgagtctctctctttgggacggatgccccagctgtggtcaactgtcttcac
atcctggcacgctccctggatgccaggacggtgatgaagtcaggccccgagatcgtgaag
gctggcctccgttccttctttgagagtgcctcagaggacattgagaagatggtagagaac
ctgcggctaggcaaggtgtcacaggcacgcacacaggtgaagggtgtgggccagaacctc
acctacaccaccgtggccctgctgcccgtcctcaccaccctcttccagcacatcgcccag
caccagtttggagatgatgtcatcttggatgacgtccaggtctcatgctaccgaacactg
tgcagtatctactctctgggaacgaccagaaactcttatgtggaaaagctgcgaccagcc
cttggggagtgtctggcccgcctggcagcggccatgcctgtggcgttcctggaacctcag
ctgaacgagtataatgcctactcagtgtacaccaccaagtctccccgggagcgggccatc
ttggggctccccaacagcgtggaggagatgtgccctgacatcccggtgctggagcggctc
atggcagacatcggggggctggccgagtcaggggcccgctacacagagatgccacatgtc
attgagatcacgttgcccatgctgtgcagctacctgccccgctggtgggaacgtgggcct
gaggtgcccccacccgccctgcctgctggggtccccccaccctgtacagctgtcacctct
gaccacctcaactccctgttggggaatatccttcgaatcatcgtcaacaacctgggcatt
gacgaggcctcgtggatgaagcggcttgctgtgtttgcccagcccatcgtgagccgggct
agaccagagctcctgcactcacactttatcccgaccattgggcggctgcgcaagcgggcg
gggaaggtggtggccgaggaggagcagctgcgcctggaggccaaggcagaagctgaggag
ggtgagctcctggtgcgggacgagttctctgtgctctgccgggacctgtatgccctctat
cctctactcatccgctacgtggacaacaacagggcgcactggctgacggagcccaacccc
agcgctgaggagctgttcaggatggtgggcgagatcttcatctactggtgcaagtcccat
aactttaagcgtgaggagcagaacttcgtggtccagaatgagatcaacaacatgtctttt
ctgactgctgacaacaagagcaaaatggccaagtcaggtggctcagaccaggaacgtacc
aagaagaagcgtcggggggaccggtactctatacagacatctctgattgtggccacgctc
aagaagatgctgcccatcggcctgaacatgtgtgcacccactgaccaggacctcatcgcg
cttgccaagacccgctatgccttgaaagacacggatgaggaggtccgggaatttctgcat
aacaatcttcaccttcagggaaaggtggaaggctccccttctctgcgctggcagatggcc
ctgtaccggggcctcccgggccgcgaggaggacgcggacgaccccgaaaagatcgtgcgc
agagtccaggaggtgtccgcggtgctctaccacctggagcaggtggagcacccgtacaag
tccaagaaggccgtgtggcacaagctcttgtccaagcagcgtcggagggcggtcgttgcc
tgcttccgcatgacccccctgtacaacctgcccacgcaccgggcatgtaacatgttcctg
gagaggtacaaggccacctggatcctgactgaagaccacagttttgaggaccgcatgata
gatgacctttcaaaagctggggagcaggaggaagaagaggaagaagtggaggaaaagaag
ccagaccccctgcaccaactggtcctgcactttagccgcactgccttgactgaaaagagc
aaactggatgaagattacctatacatggcatatgctgatatcatggcaaagagctgtcac
ctggaggagggaggggagaacggcgaagctgaagaagaggttgaggtttcatttgaggag
aaagagatggagaagcagaggctcctgtaccagcaggcgaggctgcacaaccgaggggct
gcggagatggtgctgcagatgatcagtgcctgcaaaggagagacgggagccatggtgtcc
tccaccctgaagctgggcatctccatcctaaatgggggcaatgctgatgtgcagcagaaa
atgctggattatctgaaggacaagaaggaagttggcttcttccagagtatccaggcgctg
atgcagacatgcagcgtcctggatctcaatgcattcgagagacagaacaaggcggaaggc
ctgggcatggtgaacgaggacgggaccgtcatcaaccgccagaacggagagaaggtcatg
gcagatgatgaattcacccaagacctgttccgatttctgcaattgctctgtgaggggcat
aataatgatttccaaaactacctacggacacagacagggaacacgaccactattaacatc
atcatctgtacggtggactacctcctgcggctccaggagtccatcagcgacttctactgg
tactactccggcaaggatgtcatcgaggagcagggcaagaggaacttctccaaggccatg
tcggtggcgaaacaggtgttcaacagcctcaccgagtacatacagggcccctgcaccggg
aaccagcagagcctggcgcacagccgcctctgggacgccgtggtgggattcctgcacgtg
tttgcccacatgatgatgaagctagctcaggactcgagccaaattgaactgttgaaggag
ctgctggatctacagaaggacatggtggtgatgttgctgtcactactagaagggaacgtg
gtgaacggcatgattgcccggcagatggtggacatgctggtggaatcctcatccaatgtg
gagatgatcctcaaattctttgacatgttcctgaaactcaaggacatcgtgggctcagag
gccttccaggactatgtcactgatccccgtggcctcatttccaagaaggacttccagaag
gccatggacagccagaagcagttcagcggcccggaaatccagttcctgctgtcctgctcc
gaggcggatgaaaacgagatgatcaactgcgaggagttcgccaaccgcttccaggagccg
gcgcgcgagatcggcttcaacgtggccgtgctgctgaccgacctgtcggagcacgtgccg
cacgacccgcggctgcgcaccttcctggagctggccgacagcatcctggagtacttccgc
ccctacctgggccgcatcgagatcatgggcgcctcgcgccgcatcgagcgcatctacttt
gagatctcagagaccaaccgcacccagtgggagatgccccaggtgaaggagtccaagcgc
cagttcatcttcgacgtggtgaacgagggcggcgagtcggagaagatggagctgttcgtc
agcttctgcgaggacaccatcttcgagatgcagatcgccgcgcagatctcggagcccgag
ggcgagcccgaggaggacgaggacgacggggcggccgagggctcccccatcctcaagagg
aagctgggggtggatggagaggaagaggagctgcctccagagccagagccagaacctgag
cccgagcccgagaaagccgatgctgagaatggggagaaggaagaagtccccgagctccca
ccagaaccccccaagaagacagcacctcctccaccccagccaaagaaggagaccagaggt
gggggcctggaattctggggagaactggaagtgcagagggtcaagttcctgaactacctc
tcccggaacttctacaccctacgattccttgccctcttcttggcgtttgcaatcaacttc
atcttgctgttttataaggtctcagactccccaccaggggaggatgacttggagggctca
gcagctggggacctggcaggcacagggtctggcggcggctctggctggggctcaggggcc
ggtgaagaagctgaggatgacgaagatgagaacatggtatactacttcctggaggagagc
acgggctacatggagcctgccttgcgctgcttgagcctgctgcatacactggtggccttt
ctctgcatcattggctacaactgcctcaaggtgcccctggtgatctttaagcgggagaag
gagctggcccggaagctggaatttgatggcctctacatcaccgagcagcctgaggacgac
gatgtgaaggggcagtgggaccgtctggtgcttaacacgccgtccttccccagcaactac
tgggacaagtttgtcaagcggaaggtcctagacaagcacggggacatctatgggcgagag
cggatcgccgaactgctgggcatggatctggcctcattggagattacagtccaccatgag
cgcaagcctgaaccaccgcccgggctgcttacctggcttatgtccatcgacatcaagtac
cagatctggaagttcggggtcatcttcacagacaattctttcctgtacctgggctggtac
atggtgatgtccctcctgggacactacaacaacttcttctttgctgcccacctcctggac
attgccatgggagtcaagacgctgcgcaccatcctctcctctgtcacccacaatgggaaa
cagctggtgatgactgtaggcctcctagcggtggtggtttacctgtacacggtggtggcc
ttcaacttcttccgcaagttctacaacaagagcgaggatgaagacgagcctgacatgaag
tgcgatgacatgatgacatgttacttgtttcacatgtacgtgggtgtccgagctggtggg
ggcatcggggatgagattgaggacccagcaggcgatgaatatgagctgtacagagtggtc
ttcgacatcaccttcttcttcttcgtcatcgtcatcctgctggccatcatccagggtctg
atcatcgatgctttcggcgagctccgggaccagcaagaacaagtgaaggaagatatggag
accaagtgcttcatctgtggcatcggcagcgattacttcgataccacaccccacgggttc
gagacccacactctagaggagcacaatctggccaattacatgtttttcctgatgtacctg
ataaacaaagacgagacagaacacacgggtcaggagtcttatgtgtggaagatgtaccaa
gagagatgctgggacttcttcccggctggcgattgtttccgcaagcagtacgaggaccag
cttaactga

KEGG   Miniopterus natalensis: 107542403
Entry
107542403         CDS       T05883                                 

Definition
(RefSeq) ryanodine receptor 2
  KO
K04962  ryanodine receptor 2
Organism
mna  Miniopterus natalensis
Pathway
mna04020  Calcium signaling pathway
mna04024  cAMP signaling pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna04371  Apelin signaling pathway
mna04713  Circadian entrainment
mna04911  Insulin secretion
mna04921  Oxytocin signaling pathway
mna04972  Pancreatic secretion
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05410  Hypertrophic cardiomyopathy
mna05412  Arrhythmogenic right ventricular cardiomyopathy
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107542403
   04020 Calcium signaling pathway
    107542403
   04024 cAMP signaling pathway
    107542403
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107542403
   04921 Oxytocin signaling pathway
    107542403
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107542403
   04261 Adrenergic signaling in cardiomyocytes
    107542403
  09154 Digestive system
   04972 Pancreatic secretion
    107542403
  09159 Environmental adaptation
   04713 Circadian entrainment
    107542403
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    107542403
   05022 Pathways of neurodegeneration - multiple diseases
    107542403
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107542403
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107542403
   05414 Dilated cardiomyopathy
    107542403
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107542403
   04990 Domain-containing proteins not elsewhere classified [BR:mna04990]
    107542403
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Ryanodine receptor
   107542403
Domain-containing proteins not elsewhere classified [BR:mna04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   107542403
SSDB
Motif
Pfam: RR_TM4-6 RyR RIH_assoc Ion_trans EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 YjfB_motility
Other DBs
NCBI-GeneID: 107542403
NCBI-ProteinID: XP_016075202
LinkDB
Position
Unknown
AA seq 2553 aa
MNENKKVVTFSSGVIMAVYHLWSSPGSLLQHCIIVKDSEVSFVASYDGNVVEPDMSAGFC
PDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLPDLRAAASLDTAALSATDMALALNRYLC
TAVLPLLTRCAPLFAGTEHHASLIDSLLHTVYRLSKGCSLTKAQRDSIEVCLLSICGQLR
PSMMQHLLRRLVFDVPLLNEHAKMPLKLLTNHYERCWKYYCLPGGWGSFGAASEEELHLS
RKLFWGIFDALSQKKYEQELFKLALPCLSAVAGALPPDYMESNYVSLMEKQSSMDSEGNF
NPQPVETSNIIIPEKLEYFINKYAEHSHDRWSMDKLANGWIYGETYSDSSKVQPLMKPYK
LLSEKEKEIYRWPIKESLKTMLAWGWSIERTREGDSMALYSRTRRISQTSQVSVDAAHGY
SPRAIDMSNVTLSRDLHAMAEMMAENYHNIWAKKKKIELESKGGGNHPLLVPYDTLTAKE
KAKDREKAQDILKFLQINGYAVSRGFKDLELDTPSIEKRFAYSFLQQLIRYVDEAHQYIL
EFDGGGRGKGQPFAHEQEIKFFAKVVLPLIDQYFKNHRLYFLSAASRPLCSGGHASNKEK
EMVTSLFCKLGVLVRHRISLFGNDAASIVNCLHILGQTLDARTVMKTGLESVKGALSAFL
DSAAEDLARTLENLKEGQFAHTRSQPRGATQIVNYTTVALLPVLSSLFEHIGQHQFGEDL
ILEDVQVSCYRILSSLYALGTSKSIYVERQRSALGECLAAFAGAFPVAFLETHLNKHNSY
SIYNTKSSRERAALSLPANVEDVCPNIPSLEKLMEEIVELAESGIRYTQMPHVMEVILPM
LCSYMSRWWEQGPENNPDRADLCCTALNSEHMNTLLGNILKIIYNNLGIDEGAWMKRLAV
FSQPIINKVKPQLLKTHFLPLMEKLKTKAAAVVSEEDHLKAEARGDMSEAELLILDEFTT
LARDLYAFYPLLIRFVDYNRAKWLKEPSPEAEDLFRMVAEVFIYWSKSHNFKREEQNFVV
QNEINNMSFLITDTKSKMSKAAVSDQERKKMRRKGDRYSVQTSLIVAALRRLLPIGLNIC
APGDQELIALAKNRLSMKDTEDEVRDMIRSNIHLQGKLEDPAIRWQMALYKDLPNRPEDS
ADPEKTVQRVLDIANVLFHLEQVEHPQRSKKAVWHKLLSKQRKRAVVACFRMAPLYNLPR
HRAVNLFLQGYEKSWIETEEHYFEDKLIEDLAKPGADPPEEDEGTRRVDPLHQLILLFSR
TALTEKCNLEEDYLYMAYADIMAKSCHDEEDDGEEEVKSFEEKEMEKQKLLYQQARLHER
GAAEMVLQTISASKGETGPMVAATLKLGIAVLNGGNSTVQQKMLDYLKDKKDVGFFQSLA
GLMQSCSVLDLNAFERQNKAEGLGMVTEEGSGEKVLQDDEFTCDLFRFLQLLCEGHNSDF
QNYLRTQTGNNTTVNIIISTVDYLLRVQESISDFYWYYSGKDVIDEQGQRNFSKAIQVAK
QVFNTLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMQMKLSQDSSQIELLKELMDL
QKDMVVMLLSMLEGNVVNGTIGKQMVDMLVESSNNVEMILKFFDMFLKLKDLTSSDTFKE
YDPDGKGVISKRDFHKAMESHKHYTPSETEFLLSCAETDENETLDYEEFVKRFHEPAKDI
SFNVAVLLTNLSEHMPNDSRLQTFLELAESVLNYFQPFLGRIEIMGSAKRIERVYFEISE
SSRTQWEKPQVKESKRQFIFDVVNEGGEKEKMELFVNFCEDTIFEMQLAAQISESDLNER
SASKEESEKEKPEEQGPRVGFFSVLTVRAALVALRHNLLALLRMLSLKSLKKQLKKVKKM
TVRDMVTGLFSSYWGAVTGLLHVVASVLRGFSRIVGGLLLGGSLVEGAKKIKVAELLANM
PDPTQDEVRGDGEEGERKPLEAALPSEDLADLKELTEESDLLSDIFGLDLKREGGQYKLM
PHNPNAGLGDLMGSPAPLPEGQEKVQEQEAKEEGKEETEENKSEPEKAEGEGGEKEEKAK
EGKDRQKLRLIHTHRYGEPEAPESVFWKKIIAYQQKLLNYFARNFYNMRMLALLVAFAIN
FILLFYKVSTSSVVEGKEPPPRSSGGSARASSLDGGAPGVLAVHYVLEESSGYMEPALRV
LAVLHTVISFFCIIGYYCLKVPLVIFKREKEVARKLEFDGLYITEQPSEDDIKGQWDRLV
INTQSFPNNYWDKFVKRKVMDKYGEFYGRDRISELLGMDKAALDFSDAREKKKPKKDSSL
SAVLNSIDVKYQMWKLGVVFTDNSFLYLAWYMTMSVLGHYNNFFFAAHLLDIAMGFKTLR
TILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDGDAPDMKCDDMLTCYM
FHMYVGVRAGGGIGDEIEDPAGDEYEIYRIIFDITFFFFVIVILLAIIQGLIIDAFGELR
DQQEQVKEDMETKCFICGIGNDYFDTVPHGFETHTLQEHNLANYLFFLMYLINKDETEHT
GQESYVWKMYQERCWEFFPAGDCFRKQYEDQLN
NT seq 7662 nt   +upstreamnt  +downstreamnt
atgaatgaaaacaagaaagttgtgactttttcttctggggtgattatggccgtgtatcat
ctgtggtcttcccctgggtccttgcttcaacattgcatcatcgttaaagattctgaggta
tcctttgtggcatcttacgatgggaatgtggtggagcccgacatgtctgcggggttttgc
ccagatcacaaggcagccatggttttgttccttgacagggtctatggaattgaggttcaa
gatttcctcctgcatctcctagaggttggctttctgccagatctccgggctgctgcttct
ttagatacggctgctttgagtgctacggacatggccttggccctcaaccggtacctttgc
acggccgtgctgcctctgttaacgagatgtgctcctctttttgctggcacagagcaccac
gcctccctcatcgactcgctgcttcacaccgtgtacaggctttctaagggctgctccctg
accaaagctcagcgcgactccatagaagtctgcttgctctctatttgcggccaactgagg
ccttctatgatgcagcacttactcagaagattagtgtttgacgtcccgttattaaatgaa
catgcaaagatgcctctcaagctgctgacaaatcattacgaaaggtgctggaagtactac
tgtctgcccggagggtggggcagctttggagctgcctcagaagaagaacttcatttatca
agaaaactgttctggggcatttttgatgccctgtctcaaaagaagtacgagcaggagctc
ttcaagctggccctgccgtgcctgagcgccgtggccggagccctgcccccggactacatg
gagtccaactatgtgagtttgatggagaagcagtcgtccatggattccgaggggaacttc
aacccacagcccgttgaaacctcaaatattataattcctgagaagctggaatacttcata
aataaatacgctgagcactctcatgacagatggtccatggacaagttagccaatggatgg
atttatggagaaacctactcagactcgtctaaagttcaaccattaatgaagccatataaa
ctgttatctgaaaaggaaaaagaaatttatcgctggccaatcaaagagtccttgaaaacg
atgctggcgtggggatggagcatcgagcgcacgcgggagggggacagcatggccctctat
agccggactcggcgcatttcccagaccagccaggtttctgtggacgctgcccatgggtac
agccccagggccattgacatgagcaacgtcacactgtccagggacctgcatgctatggca
gaaatgatggccgaaaactaccataatatatgggcaaagaaaaagaaaattgaactggag
tccaaaggaggcgggaaccaccccctgctggtaccgtatgacacgctgacggccaaagag
aaagccaaggacagggagaaagcgcaggacatcctcaagttcctgcagatcaatgggtac
gctgtgtccagagggttcaaggacctggaactggacaccccttctattgagaagcgattt
gcctacagtttcctccagcagctcatccgctacgtggacgaagcccatcagtatatcttg
gagtttgatggtggcggcagaggcaaagggcagcccttcgcgcacgagcaagagatcaag
ttctttgctaaagtcgttctgcctttaattgatcagtatttcaaaaaccaccgcttatac
ttcctgtctgctgcgagccggccgctctgctccgggggacatgcctcgaacaaggagaag
gagatggtgacaagcctgttctgcaaactcggagttcttgtcaggcataggatctcactg
tttggaaacgatgcagcgtccattgtcaactgtcttcacatcctggggcagactctggat
gcaaggacggtcatgaagacgggcctggagagcgtgaagggcgcgctcagcgcgtttctg
gacagcgcggcggaggacctggccaggacgctggagaacctgaaggagggccagttcgcg
cacacccgcagccagccccgcggtgccacgcagatcgtcaactacacgacggtggccctg
ctgcccgtgctgtcctcgctgttcgagcacatcggccagcaccagttcggagaggacctg
atactggaagacgtacaggtgtcctgttaccggatcctgagcagcttgtatgctttggga
accagcaagagtatttatgtggaaaggcagcgctcggcgctgggcgagtgtctggcggcc
ttcgctggggcctttcctgtggcgtttctggagactcatctgaacaaacataacagctac
tccatctacaacaccaagtcctcgcgggagagagcagctctcagtttgccagctaatgtg
gaagatgtttgtccaaatataccatctttggagaaactcatggaggagatcgtggagctc
gccgagtctgggatccgctacacgcagatgccacacgtgatggaggtcatcctgcccatg
ctttgcagctacatgtcccggtggtgggagcaggggcctgagaacaacccggaccgggcc
gacctgtgctgcacggctctcaactccgagcacatgaacacgctgctggggaacattctg
aaaatcatatacaacaacttggggattgatgagggggcctggatgaagaggctggcagtg
ttctcccagcccattataaataaagtgaaacctcagctcttgaaaacgcatttcctgccg
ctgatggagaagctgaagacgaaggcagcggcggtggtttcagaggaggaccacctgaaa
gccgaggcccgtggcgacatgtccgaggccgagctgctcattctggacgagttcaccacg
ctggcccgagacctctacgccttctaccctctgctgattagattcgtggactacaacagg
gcaaagtggctcaaagagcccagcccggaagccgaggacctgttccgcatggtggccgag
gtgttcatctactggtccaagtcccacaacttcaagagagaagagcagaactttgtcgtc
cagaatgaaatcaacaacatgtctttcctcatcaccgacaccaagtcaaagatgtcaaag
gcggccgtttctgaccaggaaaggaagaagatgcggcggaagggagaccgctactccgtg
cagacctccctcatcgtggccgcactgaggcggctgctgcccatcgggctgaacatctgc
gcccccggggaccaggagctcatcgccctggccaagaaccggctgagcatgaaagacaca
gaggatgaagtccgagatatgatccgcagtaatatccatttgcaaggcaagctggaggat
cctgctattcggtggcaaatggctctttacaaagacctaccgaacagacctgaggacagc
gctgaccctgagaagaccgtgcagagggtcctggacatagccaatgtgctcttccatctt
gagcaggtggagcacccgcagaggtccaagaaggccgtgtggcacaagctgctgtccaag
cagcggaagcgggcggtggtggcctgcttccgaatggccccgctctacaacctgccaagg
catcgggccgtcaatctctttcttcagggatatgagaagtcctggattgaaacagaagag
cactactttgaggataaactgatagaagacttagcaaaaccgggggcggaccctccagag
gaagacgagggcacgaggagagttgatcctctgcatcagctcatccttctgttcagccga
acggccctaacggagaaatgcaacctggaggaagactatttatacatggcttacgcagat
attatggcaaagagttgccatgatgaggaagacgacggtgaagaggaagtgaagagtttt
gaagaaaaagaaatggagaagcaaaagcttctgtaccagcaagcccggctgcacgagcgc
ggcgccgccgagatggtgctgcagaccatcagcgccagcaaaggtgaaacgggcccaatg
gtggctgccactctgaaactcgggattgccgtcttgaacggcgggaactccacggtgcag
cagaagatgctcgactacctgaaggacaagaaggacgtaggcttcttccagagcctggcc
ggcctgatgcagtcctgcagtgtcctcgacctcaacgccttcgagcgacagaacaaggcg
gaaggacttgggatggtgaccgaggaaggatcaggagaaaaggttcttcaggatgacgag
ttcacctgtgacctcttccgcttcctgcagctgctttgtgagggacacaactcagatttt
cagaattatctgagaactcagaccggcaacaacaccaccgtgaatatcatcatctccacc
gtggactacctgctgcgggtccaggagtccatcagtgacttctattggtattactccggg
aaggacgtcatcgatgagcagggacagcgcaacttctccaaagcaattcaagtagcaaag
caagtctttaacaccctcacggagtacattcagggtccctgcactgggaatcagcagagc
ctggcccacagcaggctctgggacgcggtggtgggcttcctccacgtattcgcccacatg
cagatgaagctgtctcaggattccagtcaaattgagctactgaaagaactgatggacctt
cagaaggacatggtggtcatgctgctgtccatgctggaaggtaacgttgtgaatggaacc
atcggcaagcagatggtcgacatgctcgtggagtcttccaacaacgtggagatgatcctc
aagttcttcgatatgttcttaaaactaaaagatttgacatcttctgatacatttaaggaa
tacgaccccgatggcaagggagtcatctccaagagggacttccacaaggcgatggaaagc
cacaagcactacacgccgtcggagaccgagttcctcctgtcctgtgcggagacggatgaa
aacgaaaccctggactacgaggagtttgtcaaaaggttccacgagcccgcgaaggacatc
agcttcaacgtggccgtcctgctgacgaacctttcggagcacatgcccaacgactcgcgg
ctgcagaccttcctggagctggcggagagcgtgctcaactacttccagcccttcctgggc
cgcatcgagatcatgggcagcgccaagcgcatcgagagggtgtacttcgagatcagcgag
tccagccgcacgcagtgggagaagccccaggtcaaggagtccaagaggcagttcattttt
gacgtggtcaacgagggcggcgagaaggagaagatggagctgttcgtgaacttctgcgag
gacaccatctttgagatgcagctggcggcccagatctcagagtcggacctgaacgagagg
tcagccagcaaggaggagagtgagaaggagaagccggaggagcagggcccgagggtgggg
ttcttctccgtcctgaccgtccgggcggccctggtggctctcaggcacaacctgctggcc
cttctgcgcatgctcagcctcaagagcctgaagaagcagctgaagaaggtgaagaagatg
acagtgagggacatggtcactgggctcttctcctcctactggggcgctgtgaccggcctg
ctgcacgtcgtggcgagcgtgctcaggggcttctctcgcattgtggggggcctgctcctg
gggggcagcctggtggaaggcgccaagaagatcaaggtggcggagctcttggccaacatg
ccggaccccacgcaggacgaggtgaggggggatggggaggagggcgagaggaagcccctg
gaggccgccctgccctcggaggacctcgcggacctgaaggagctgactgaggagagtgac
ctgctctcggacatatttggcttggacctgaagagagagggagggcagtacaaactcatg
cctcacaacccgaatgctggcctgggcgacctcatgggcagccctgcgccccttcccgag
gggcaggaaaaggttcaggagcaggaggccaaagaggaaggaaaggaagagacagaagaa
aacaagtcggaacctgagaaagccgagggagaaggcggagaaaaagaagagaaggccaag
gaggggaaggacagacagaagctccggctgatccacacgcacagatacggggagccagag
gcgcccgagtcggtgttctggaagaagatcatagcttatcagcagaagctgctgaactat
tttgctcgcaacttctacaacatgaggatgttagccttgctggtcgcctttgccatcaac
ttcatcttgctgttctataaggtctccacttcttctgtggttgaaggaaaggagcccccc
cctcgcagctcaggcgggagcgcccgggccagcagcctggacgggggcgcgcccggcgtc
ctcgcggtgcactacgtgctggaggagagcagcggctacatggagcccgcgctgcgcgtc
ctggccgtgctgcacacggtcatctcctttttctgcatcatcggctactactgcctgaaa
gtcccgctggttatttttaagcgtgaaaaggaagtagctcgaaaattggagtttgatggg
ctttatatcacagaacagccttcagaagatgatattaaaggccagtgggatagactcgtg
atcaacacacagtcatttcccaacaactactgggacaaatttgttaaaagaaaggttatg
gataaatatggcgagttctatggccgggacagaattagtgagctgcttggcatggacaaa
gccgccctggacttcagcgatgcccgggagaagaagaagccgaagaaagacagctccctg
tcggctgtactgaactccatcgacgtgaagtatcagatgtggaaactcggagtcgtgttc
actgacaactccttcctctacctcgcctggtacatgaccatgtctgtccttgggcactac
aacaacttcttctttgctgcccatcttctcgacattgctatggggttcaagacgctgagg
accatcctgtcgtcagtcactcacaatggcaagcagctggtgctgaccgttggcttactg
gctgtcgtcgtatacctgtacacggtggtggcattcaatttcttccgaaaattctacaat
aaaagcgaagatggtgacgcaccagacatgaaatgtgatgatatgctcacgtgctacatg
ttccacatgtacgtgggcgtgcgagccggaggcggcatcggtgacgagatcgaggacccg
gcgggggacgagtacgagatctatcggatcatcttcgacatcaccttcttcttctttgtc
attgtcatcctcttggctatcatacaaggtttaattattgatgcttttggagaactgaga
gaccagcaggagcaagtcaaagaggacatggagaccaagtgcttcatctgcgggataggc
aatgactacttcgacacggtgccacacggcttcgaaacccacaccttacaggagcacaac
ttggccaattacctgtttttcctgatgtatctcataaataaagatgaaacagagcacaca
ggacaggaatcttatgtgtggaaaatgtatcaggagagatgctgggagttcttccctgca
ggggactgtttccggaaacagtatgaagaccagctgaattaa

DBGET integrated database retrieval system