KEGG   Miniopterus natalensis: 107527103
Entry
107527103         CDS       T05883                                 

Gene name
GABRR3
Definition
(RefSeq) LOW QUALITY PROTEIN: gamma-aminobutyric acid receptor subunit rho-3
  KO
K05190  gamma-aminobutyric acid receptor subunit rho
Organism
mna  Miniopterus natalensis
Pathway
mna04080  Neuroactive ligand-receptor interaction
mna04723  Retrograde endocannabinoid signaling
mna04727  GABAergic synapse
mna05032  Morphine addiction
mna05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107527103 (GABRR3)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107527103 (GABRR3)
   04723 Retrograde endocannabinoid signaling
    107527103 (GABRR3)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107527103 (GABRR3)
   05033 Nicotine addiction
    107527103 (GABRR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107527103 (GABRR3)
Ion channels [BR:mna04040]
 Ligand-gated channels
  GABA-A
   107527103 (GABRR3)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 107527103
NCBI-ProteinID: XP_016055221
LinkDB
Position
Unknown
AA seq 364 aa
MTFYLRHYWKDERLSFPSTANKSLTCDRRLIRKIWVPATFLGHSKRSFTHDPTVTALPLV
LHAYLAICFDGLRFPFSYSFPRITVSATCFMDFSGFPLDTQNCSLELESHAYNEEDLVLY
XRHRNGSLNTGEHISLPQFFIEESRASGGFASYSSTGWYNRLFINFVLRRRILFFVLRTY
XPWVSFWIHPRAVPAGVSLGVTTVLTMXTTVPGVSASGPRCPASRPCRGPGGGSLSVCLS
PTEFAAGSSLPGAEERERLRKAGRISGMYNIDAVQAMAFDGCHHDSETDMDQTSFSLHPE
YDSIRGRFTGSPSADPSRIERRKPPGGHVGRTILENHHVIDTYSWILFPIVYIIVNLFYW
GTYV
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgactttttatctcaggcattactggaaagatgaaaggctctcctttcctagcacagca
aacaaaagcctcacttgtgatcgtagattgatcagaaagatttgggtgcctgctaccttt
cttggccattctaaaaggtccttcacccacgacccgacggtaacagcgcttcctttagta
ttgcacgcttatttggccatatgcttcgatggcctgcggtttcccttttcttactctttt
cctaggataactgtttccgccacgtgctttatggatttcagcgggtttccccttgacact
cagaattgttcccttgagctggaaagccatgcctacaatgaagaggatctcgtgctgtac
tgaagacatagaaatgggtccttaaatactggtgagcatatttcccttcctcagttcttc
attgaagagtccagggcatccggtggatttgcctcatacagcagcacaggttggtacaat
cggcttttcatcaacttcgtgctgaggaggcgtattctcttctttgtgctgcgaacctat
nntccctgggtttcattttggattcacccaagagctgttcctgcaggagtttccttggga
gtcaccacggtgctgaccatgnccaccaccgtccctggcgtgagcgcctccgggcccagg
tgtcctgcgtcaaggccgtgccgtggacctgggggcggctccctctccgtgtgcctgtca
cccaccgagtttgcagccgggagctccctccccggagcggaggaacgggagcggctcagg
aaggcggggaggatttctggaatgtacaatattgatgcagttcaagctatggccttcgat
ggttgtcaccacgacagcgagactgacatggaccagacttccttttctctccacccagaa
tatgactccattagaggaagattcacaggcagccccagtgcagacccatccaggatagag
agaagaaaacccccgggagggcacgtcggcagaaccattctggagaaccaccatgtcatt
gacacctactcatggattttatttcccattgtgtatattatagttaatttgttttactgg
ggtacatatgtgtga

KEGG   Miniopterus natalensis: 107527855
Entry
107527855         CDS       T05883                                 

Gene name
GABRG3
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit gamma-3
  KO
K05186  gamma-aminobutyric acid receptor subunit gamma
Organism
mna  Miniopterus natalensis
Pathway
mna04080  Neuroactive ligand-receptor interaction
mna04723  Retrograde endocannabinoid signaling
mna04727  GABAergic synapse
mna05032  Morphine addiction
mna05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107527855 (GABRG3)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107527855 (GABRG3)
   04723 Retrograde endocannabinoid signaling
    107527855 (GABRG3)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107527855 (GABRG3)
   05033 Nicotine addiction
    107527855 (GABRG3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107527855 (GABRG3)
Ion channels [BR:mna04040]
 Ligand-gated channels
  GABA-A
   107527855 (GABRG3)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 107527855
NCBI-ProteinID: XP_016056209
LinkDB
Position
Unknown
AA seq 451 aa
MLSRRAEEEDDEGASSNQKWVLAPKSQDTDVTLILNKLLREYDKKLRPDIGVKPTIIDVD
IYVNSIGPVSSINMEYQIDIFFAQTWTDSRLRFNSTMKILTLNSNMVGLIWIPDTIFRNS
KTAEAHWITTPNQLLRIWNDGKILYTLRLTINAECQLQLHHFPMDEHSCPLIFSSYGYPK
EEMIYRWRKNSVETANQKSWRLYQFDFMGLRNTTEIVTTSAGDYVVMTIYFELSRRMGYF
TIQTYIPCILTVVLSWVSFWIKKDATPARTALGITTVLTMTTLSTIARNSLPRVSYVTAM
DLFVTVCFLFVFAALMEYATLNYYSSCRKPPTTKKKTSLLHPDSSRWIHERITLQAPSNY
SLLDMRPPPPTMITFNNSLYWHEFEDTCVYECLDGKDCQSFFCCYEECRSGSWRRGRIHI
DVSELDSYSRVLFPTSFLLFNLVYWVGYLYL
NT seq 1356 nt   +upstreamnt  +downstreamnt
atgttgtccagaagggcagaggaggaagacgatgaaggggcatcatccaaccagaagtgg
gtcctggctcccaaatcccaagacaccgacgtgactctcatcctcaacaagctgctgaga
gaatacgacaaaaagctgaggccagacattggggtgaaaccgaccataatcgatgttgac
atctatgttaacagcattggtcctgtgtcatcaataaacatggaataccaaattgatata
ttttttgcccagacctggacggacagtcgcctccggttcaacagcacaatgaagatcctg
acgctgaacagcaacatggtggggctcatctggatccccgacaccatcttccgcaactcc
aagacggccgaggcgcactggatcaccacgcccaaccagctgctgcgcatctggaacgac
ggcaagatcctctacacgctcaggctcaccatcaatgccgagtgccagctgcagctgcac
cacttccccatggacgagcactcctgcccgctgatcttctccagctatggctaccccaag
gaggagatgatttacagatggaggaaaaactcagtggagacggccaatcagaagtcctgg
cggctttatcagtttgactttatgggcctcagaaacaccaccgagatcgtgacgacgtct
gcaggtgactacgtcgtcatgaccatctactttgaactgagcagaaggatggggtacttc
accatccagacgtacatcccctgcatcctgactgtggttttatcctgggtgtcattctgg
atcaagaaagacgcgacaccagcaagaacagcattaggcatcaccacagtgctgaccatg
accacgctcagcaccatagccaggaactccttgccccgcgtgtcctacgtgaccgccatg
gacctcttcgtgaccgtgtgcttcctgtttgtcttcgcggctctgatggagtacgccacc
ctcaactactactcgagttgtagaaaaccacccaccactaagaagaaaacatcgttactg
catccagactcctcgaggtggattcacgagcgaataaccctgcaggccccctctaactac
tccctcctcgacatgcggcctccgccccccacgatgatcaccttcaacaactccttgtac
tggcacgagttcgaagacacctgtgtctacgagtgtctcgacggcaaggactgccagagc
ttcttctgctgctacgaagagtgcaggtccgggtcctggaggagagggcgcatccacata
gacgtctcggagctggactcgtactcccgggtcctctttcccacgtccttcctgctcttc
aacctggtctactgggtcgggtacctgtatctctga

KEGG   Miniopterus natalensis: 107527865
Entry
107527865         CDS       T05883                                 

Gene name
GABRA5
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit alpha-5
  KO
K05175  gamma-aminobutyric acid receptor subunit alpha
Organism
mna  Miniopterus natalensis
Pathway
mna04080  Neuroactive ligand-receptor interaction
mna04723  Retrograde endocannabinoid signaling
mna04727  GABAergic synapse
mna04742  Taste transduction
mna05032  Morphine addiction
mna05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107527865 (GABRA5)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107527865 (GABRA5)
   04723 Retrograde endocannabinoid signaling
    107527865 (GABRA5)
  09157 Sensory system
   04742 Taste transduction
    107527865 (GABRA5)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107527865 (GABRA5)
   05033 Nicotine addiction
    107527865 (GABRA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107527865 (GABRA5)
Ion channels [BR:mna04040]
 Ligand-gated channels
  GABA-A
   107527865 (GABRA5)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD CytochromB561_N DUF5874
Other DBs
NCBI-GeneID: 107527865
NCBI-ProteinID: XP_016056218
LinkDB
Position
Unknown
AA seq 420 aa
MDNGMFSSSVMVKNLLLFCVSMNLAGRLGFSQMPAGSVKDDNITIFTRILDGLLDGYDNR
LRPGLGERITQVRTDIYVTSFGPVRAPWCDCFHALRTCIIRGKRGCERLKLKAGLCHLVA
RRPRLTISAECPMQLEDFPMDAHACPLKFGSYAYPNSEVVYVWTNDTTKSVVVAEDGSRL
NQYHLMGQTVGTENITTSTGEYTIMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLN
RESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVN
YFTKRGWAWDGKKALEAAKIKKKQRELTLSKSTNAYTTGRMTHAPNIPQEPAPGTSGGAA
ASANPPEDKPPESRKTYNSISKIDKMSRIVFPVLFGTFNLVYWATYLNREPVIKGASPPK
NT seq 1263 nt   +upstreamnt  +downstreamnt
atggacaatgggatgttctcgagctctgtcatggtcaagaacctcctgctcttctgtgtc
tccatgaacctggccggtcgcctgggcttttcgcagatgccagccggctcggtaaaggat
gacaacatcaccatcttcacccggatcttggacgggctcttggatggctacgacaacagg
ctgcggccggggctcggggagcgcatcacgcaggtgaggacggacatctacgtgaccagc
ttcggccccgtacgggcaccctggtgtgattgtttccacgccctgcggacttgcatcatt
cgtgggaaacgcggctgtgaacggcttaagctcaaggccggactctgtcatttagtcgcc
aggaggcctcgcttgaccatctctgcggagtgtccgatgcagcttgaggacttcccgatg
gacgcccacgcctgccccctgaagtttggcagctacgcgtaccccaactccgaggttgtc
tacgtttggaccaacgacaccaccaagtcggtggtggtggcggaagacggctcccggctg
aaccagtaccacctgatggggcagacggtgggcacggagaacatcaccaccagcacgggt
gagtacaccatcatgacggctcatttccacctgaagaggaagatcggctactttgtcatc
cagacctacctgccctgcatcatgaccgtgatcctgtcgcaggtctccttttggctgaac
cgggagtccgtccccgccaggacagtgttcggggtgaccacggtgctgaccatgaccacg
ctcagcatcagcgcccggaactcgctgcccaaggtggcctacgccacggccatggactgg
ttcatcgccgtgtgctacgccttcgtgttctccgcgctcatcgagttcgccaccgtcaac
tacttcaccaagcggggctgggcctgggacggcaagaaggccctggaagctgccaagatc
aagaaaaagcagcgtgagctcacactcagtaagtcaacgaacgcctataccaccgggagg
atgacccacgcccccaacatcccgcaggagccggccccgggcacctccggcggggccgcc
gcctccgcaaaccctcccgaggacaagccccccgagagcagaaagacttacaacagcatc
agcaagatcgacaagatgtcccgaattgtattccccgtcctgttcggcaccttcaacctg
gtttactgggcgacgtatttgaacagggagcccgtgattaagggggcctcgcctccgaag
tga

KEGG   Miniopterus natalensis: 107528034
Entry
107528034         CDS       T05883                                 

Gene name
GABRB3
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit beta-3 isoform X1
  KO
K05181  gamma-aminobutyric acid receptor subunit beta
Organism
mna  Miniopterus natalensis
Pathway
mna04080  Neuroactive ligand-receptor interaction
mna04723  Retrograde endocannabinoid signaling
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna05032  Morphine addiction
mna05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107528034 (GABRB3)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107528034 (GABRB3)
   04726 Serotonergic synapse
    107528034 (GABRB3)
   04723 Retrograde endocannabinoid signaling
    107528034 (GABRB3)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107528034 (GABRB3)
   05033 Nicotine addiction
    107528034 (GABRB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107528034 (GABRB3)
Ion channels [BR:mna04040]
 Ligand-gated channels
  GABA-A
   107528034 (GABRB3)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD OAD_gamma
Other DBs
NCBI-GeneID: 107528034
NCBI-ProteinID: XP_016056435
LinkDB
Position
Unknown
AA seq 388 aa
MYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHP
DGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDSAVTGVER
IELPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSF
WINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYA
FVNYIFFGRGPQRQKKLAERTAKAKNDRSKSESNRVDAHGNILLTSLEVHNEMNEVAGGV
GETRNSAISFDNSGIQYRKQSMPREGHGRHLGDRGLPHKKTHLRRRSSQLKIKIPDLTDV
NAIDRWSRIVFPFTFSLFNLVYWLYYVN
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgtatttccaacaatactggagagataagaggctcgcctattccgggatcccgctcaac
ctcacgctggacaaccgcgtggcggaccagctgtgggtgcctgacacttatttcttaaat
gacaagaagtcgttcgtgcacggagtgacggtgaaaaaccgcatgatccggcttcacccc
gacggcaccgtgctctacgggctcagaatcaccacaaccgcggcctgcatgatggatctg
agaaggtaccccctggacgagcagaactgcaccctggaaattgaaagctatggctacacc
acggatgacattgaattctactggcgcggtggcgacagtgctgtcaccggagtggagagg
attgagctccctcagttctccattgtggagcatcgcctggtctccaggaatgtcgtcttt
gccacaggtgcctacccccggctctccctgagcttccggctgaagaggaacatcgggtac
ttcattctgcagacctacatgccctccattctcatcaccattctctcctgggtgtccttc
tggatcaattacgacgcctccgcggccagggtggccctggggatcaccaccgtcctgacg
atgaccaccatcaacacgcaccttcgggagaccttgcccaaaatcccctacgtcaaagcc
attgacatgtacctcatgggctgctttgtcttcgtgttcctggccctcctggagtacgcc
ttcgtcaactacatcttctttgggagaggccctcagaggcagaagaagcttgccgagagg
acagccaaggccaagaacgaccgttcaaagagcgaaagcaaccgggtggatgctcatggg
aatatcctgttaacgtccctggaggttcacaacgaaatgaatgaggtggcgggcggcgtc
ggggagaccaggaattcagcaatatccttcgacaactcaggaatccagtacaggaaacag
agcatgcccagggaagggcatgggcggcacctgggggaccggggcctgccgcacaagaag
acccacctacggaggaggtcttcacagctcaaaattaagatccccgatctcaccgacgtg
aacgccatagacaggtggtcccggatcgtgtttcctttcacgttttctctcttcaacttg
gtttactggctctactacgttaactga

KEGG   Miniopterus natalensis: 107532484
Entry
107532484         CDS       T05883                                 

Gene name
GABRG1
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit gamma-1 isoform X1
  KO
K05186  gamma-aminobutyric acid receptor subunit gamma
Organism
mna  Miniopterus natalensis
Pathway
mna04080  Neuroactive ligand-receptor interaction
mna04723  Retrograde endocannabinoid signaling
mna04727  GABAergic synapse
mna05032  Morphine addiction
mna05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107532484 (GABRG1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107532484 (GABRG1)
   04723 Retrograde endocannabinoid signaling
    107532484 (GABRG1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107532484 (GABRG1)
   05033 Nicotine addiction
    107532484 (GABRG1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107532484 (GABRG1)
Ion channels [BR:mna04040]
 Ligand-gated channels
  GABA-A
   107532484 (GABRG1)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 107532484
NCBI-ProteinID: XP_016062356
LinkDB
Position
Unknown
AA seq 465 aa
MGAWKASLFSPFLLRSHSRGVRLMFLLLTLHLGNCVDKADDEDDEDLTVNKTWVLAPKIH
EGDITQILNSLLQGYDNKLRPDIGVRPTVIETDVYVNSIGPVDPINMEYTIDIIFAQTWF
DSRLKFNSTMKVLMLNSNMVGKIWIPDTFFRNSRKSDAHWITTPNRLLRIWNDGRVLYTL
RLTINAECYLQLHNFPMDEHSCPLEFSSYGYPKNEIEYKWKKPSVEVADPKYWRLYQFAF
VGLRNSTEISHTISGDYVIMTIFFDLSRRMGYFTIQTYIPCILTVVLSWVSFWINKDAVP
ARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFAALMEYGTLHYFTSN
KKAKTARDRKLKNKASISPALHAGSTLIPMNSVSLPHGEDDYGYQCLEGKDCASFFCCFE
DCRTGSWRQGRLHIRVAKIDSYSRIFFPTAFALFNLVYWVGYLYL
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgggggcttggaaagcttctctcttctccccctttctcctgcggagtcacagtagaggg
gtgaggctgatgttcttgctgctgaccctgcatttgggcaactgtgttgataaagcagat
gatgaagatgatgaggacttaacagtgaacaaaacttgggtcttggcaccaaagattcat
gaaggagacataacacaaattctcaactcattgctccaaggctatgacaataaacttcgc
ccagatataggagtgaggcccacagtaattgaaactgatgtttatgtcaacagcattgga
ccagttgatcccataaatatggaatacactattgatataatttttgcccagacctggttt
gatagtcgtttaaaattcaatagtaccatgaaagtgcttatgcttaacagtaatatggtt
ggaaaaatctggattcctgatactttcttcagaaactcaagaaaatccgatgctcactgg
ataacaacacctaatcgtctgcttcgaatttggaacgatggacgagttctatacactttg
agattgacaattaatgcagagtgttaccttcagcttcataactttcctatggatgaacat
tcctgtccactagaattttcaagctatggataccctaaaaatgaaattgagtataagtgg
aaaaagccttctgtagaagtggctgatcctaaatattggagattgtatcagtttgcattt
gtagggttgcggaactcaactgaaatttctcacacaatctctggggattatgttatcatg
acaattttttttgacctgagcagacgaatgggatatttcactattcagacctacattcca
tgtattctgacagttgtactttcttgggtgtctttttggatcaataaagatgcagtacct
gcaagaacctcactgggtattaccacagttttgactatgaccactctgagtacaatagcc
aggaagtcattgcctaaggtttcttatgtcactgcgatggatctctttgtttctgtgtgt
ttcattttcgtttttgcagccttgatggaatatggcaccttgcattattttaccagcaac
aaaaaagcaaagactgctagagatagaaagctcaaaaacaaggcctcgatatcccctgca
ctccatgccggatccactctgattccaatgaacagcgtctctctgccccatggcgaagat
gactacgggtaccagtgcctggagggcaaagactgcgccagcttcttctgctgcttcgag
gactgcaggacgggctcgtggcgccagggccgcctgcacatccgcgtggccaagatcgac
tcctactcgcgcatcttcttccccaccgccttcgccctgttcaacctggtctactgggtt
ggctacctttacttataa

KEGG   Miniopterus natalensis: 107532500
Entry
107532500         CDS       T05883                                 

Gene name
GABRA2
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit alpha-2
  KO
K05175  gamma-aminobutyric acid receptor subunit alpha
Organism
mna  Miniopterus natalensis
Pathway
mna04080  Neuroactive ligand-receptor interaction
mna04723  Retrograde endocannabinoid signaling
mna04727  GABAergic synapse
mna04742  Taste transduction
mna05032  Morphine addiction
mna05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107532500 (GABRA2)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107532500 (GABRA2)
   04723 Retrograde endocannabinoid signaling
    107532500 (GABRA2)
  09157 Sensory system
   04742 Taste transduction
    107532500 (GABRA2)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107532500 (GABRA2)
   05033 Nicotine addiction
    107532500 (GABRA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107532500 (GABRA2)
Ion channels [BR:mna04040]
 Ligand-gated channels
  GABA-A
   107532500 (GABRA2)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb CytochromB561_N DUF5522
Other DBs
NCBI-GeneID: 107532500
NCBI-ProteinID: XP_016062367
LinkDB
Position
Unknown
AA seq 449 aa
MRPTVGSAQLLLLASLVGGPARLVLANIQEDGPENNITIFTRILDRLLDGYDNRLRPGLG
DSITEVFTNIYVTSFGPVSDTDMEYTIDVFFRQKWKDERLKFKGPMNILRLNNLMASKIW
TPDTFFHNGKKSVAHNMTMPNKLLRIQDDGTLLYTMRLTVQAECPMHLEDFPMDAHSCPL
KFGSYAYTTSEVTYIWTYNASDSVQVAPDGSRLNQYDLLGQSIGKETIKSSTGEYTVMTA
HFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARN
SLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWAWDGKSVVNDKKKEKATVMI
QNNAYAVAVANYAPNLSKDPVLSTISKSATTPEPNKKPENKPAEAKKTFNSVSKIDRMSR
IVFPVLFGTFNLVYWATYLNREPVLGVSP
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgaggccgaccgtgggcagcgcgcagctgctgctgctggcctccctggtggggggcccc
gccaggttggtgctggctaacatccaagaagatgggcctgaaaataacattaccatcttt
acaagaattctagacagacttctggatggttacgataatcggctgagaccaggactggga
gacagtattactgaagtcttcactaacatctacgtgaccagttttggccctgtctcagat
acagatatggaatatacaatagatgttttctttcgacaaaaatggaaagatgaaaggtta
aaatttaaaggtcctatgaacatccttcgacttaacaatttaatggctagcaaaatctgg
actccagacaccttctttcacaatgggaaaaaatcagtagctcataacatgacaatgccc
aataaactccttaggatccaggatgatgggacgctgctgtacacaatgaggcttacagtt
caagctgaatgtccaatgcacttggaggattttccaatggatgctcactcatgtcctctg
aaatttggcagctatgcatatacaacctcagaggtcacatatatttggacttacaatgcc
tctgattcagtccaagttgctcctgatggctccaggttaaatcagtatgacctgttgggc
caatcaattgggaaggaaacaattaaatccagtacaggtgaatatactgtaatgacagct
catttccacttgaaaagaaaaattgggtattttgtgattcaaacatacctgccttgcatc
atgactgtcattctctcccaagtgtcattctggcttaacagagaatctgtgcctgcaagg
actgtatttggtgtaacgactgttctaacaatgacaactctaagcatcagtgctcggaat
tctctccccaaagtggcttacgcaactgctatggattggtttattgcagtttgttacgca
tttgtgttctctgccctaattgagtttgcaactgttaattacttcaccaaaagaggatgg
gcttgggatgggaagagtgtagtgaatgacaagaaaaaagagaaggccaccgtcatgata
cagaacaatgcctatgcagtggctgtcgccaattatgccccgaatctttcaaaagaccca
gtgctctccaccatctccaagagtgcaaccacgcccgagcccaacaagaagccggagaac
aagccagctgaagccaagaaaaccttcaacagtgttagcaaaatcgacagaatgtccaga
atagttttcccagttttgttcggcacatttaatttagtttactgggctacatatttaaac
agggaacctgtattaggggtcagcccttga

KEGG   Miniopterus natalensis: 107533097
Entry
107533097         CDS       T05883                                 

Gene name
GABRA4
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit alpha-4
  KO
K05175  gamma-aminobutyric acid receptor subunit alpha
Organism
mna  Miniopterus natalensis
Pathway
mna04080  Neuroactive ligand-receptor interaction
mna04723  Retrograde endocannabinoid signaling
mna04727  GABAergic synapse
mna04742  Taste transduction
mna05032  Morphine addiction
mna05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107533097 (GABRA4)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107533097 (GABRA4)
   04723 Retrograde endocannabinoid signaling
    107533097 (GABRA4)
  09157 Sensory system
   04742 Taste transduction
    107533097 (GABRA4)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107533097 (GABRA4)
   05033 Nicotine addiction
    107533097 (GABRA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107533097 (GABRA4)
Ion channels [BR:mna04040]
 Ligand-gated channels
  GABA-A
   107533097 (GABRA4)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb DUF4396
Other DBs
NCBI-GeneID: 107533097
NCBI-ProteinID: XP_016063164
LinkDB
Position
Unknown
AA seq 494 aa
MVSARKVPAIATSFGVSFALLQVLCLEACLNESPGQNPKEEKLCPENFTRILDSLLDGYD
NRLRPGFGGPVTEVKTDIYVTSFGPVSDVEMEYTMDVFFRQTWIDKRLKYDGPIEILRLN
NMMVTKVWTPDTFFRNGKKSVSHNMTAPNKLFRIMRNGTILYTMRLTISAECPMRLVDFP
MDGHACPLKFGSYAYPKSEMIYTWTKGPEKSVEVPKESSSLVQYDLIGQTVSSETIKSIT
GEYVVMTVYFHLRRKMGYFMIQTYIPCIMTVILSQVSFWINKESVPARTVFGITTVLTMT
TLSISARHSLPKVSYATAMDWFIAVCFAFVFSALIEFAAVNYFTNIQIEKAKKKTSKALQ
EIPAIPVLRATHPEAPLQNTSASLNMRKRTNVLVPPEPDVGIRTEVGTPPSSPPAAPDPA
EAPRPPLTTGNTAGAPGKPAAPAPPSAPPPSGSGTSKIDKYARILFPVTFGAFNMVYWVV
YLSKDTMEKSESLK
NT seq 1485 nt   +upstreamnt  +downstreamnt
atggtttctgccaggaaggtacccgcgatcgcgacgtccttcggagtcagtttcgctctc
ctgcaggtgctgtgcctggaggcttgtttaaacgaatccccaggacagaacccaaaggaa
gagaaattatgcccggaaaattttacccgcatcctggacagtttactggatggttacgac
aacaggctgcgtcctggatttgggggtcctgttacagaagtaaaaactgacatatatgtc
acgagctttggacctgtttctgatgttgaaatggaatacacaatggatgtgttcttcaga
cagacatggattgacaaaagactaaaatatgatggccccattgaaattctgagattgaac
aacatgatggtaacaaaagtatggacccctgatactttcttcaggaatggaaagaaatct
gtctcacataatatgacagccccaaataaactttttagaattatgagaaatggcactatt
ttatacacgatgagactcaccataagtgcggagtgtcccatgagactggtggatttccca
atggatggtcatgcatgtcctttgaaatttgggagttatgcttacccgaagagtgagatg
atttatacctggacaaaaggtcccgagaaatcggtggaagtgccaaaggagtcttccagc
ttggttcagtatgacttgattgggcaaaccgtatcaagtgaaaccatcaaatccatcacg
ggtgaatatgttgttatgacggtatacttccacctcagacggaagatgggttattttatg
attcagacgtacattccatgtattatgacagtgattctttcgcaagtttccttctggata
aataaggaatcagttccagctaggactgtatttggaataaccacagtcctcaccatgacc
acgttgagcatcagtgcccggcattctctgcccaaagtgtcctatgccactgccatggat
tggttcatagctgtctgctttgcttttgtattttccgcccttattgagtttgctgctgtc
aattattttaccaatattcaaatagaaaaagccaaaaagaagacatcgaaagctcttcag
gaaattccagctattccagtgctcagagcaacgcatcctgaagcacctctgcagaacacg
agcgccagcctgaacatgaggaaaagaacaaacgtcttggttccgcccgaacccgacgtc
ggcatcagaaccgaggtggggacccctccgagcagcccccccgcggctccggaccccgcc
gaggccccgcggccgcccttgaccacgggcaacaccgcgggggcgcctgggaagcccgcg
gcccccgcgcccccctccgccccgccgccgtctggatctggcacgagcaaaatagacaaa
tacgcccgcattctcttcccggtaacgttcggcgcctttaacatggtctattgggttgtc
tatttatcgaaggacactatggagaaatcagaaagcctcaagtaa

KEGG   Miniopterus natalensis: 107533104
Entry
107533104         CDS       T05883                                 

Gene name
GABRB1
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit beta-1
  KO
K05181  gamma-aminobutyric acid receptor subunit beta
Organism
mna  Miniopterus natalensis
Pathway
mna04080  Neuroactive ligand-receptor interaction
mna04723  Retrograde endocannabinoid signaling
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna05032  Morphine addiction
mna05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107533104 (GABRB1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107533104 (GABRB1)
   04726 Serotonergic synapse
    107533104 (GABRB1)
   04723 Retrograde endocannabinoid signaling
    107533104 (GABRB1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107533104 (GABRB1)
   05033 Nicotine addiction
    107533104 (GABRB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107533104 (GABRB1)
Ion channels [BR:mna04040]
 Ligand-gated channels
  GABA-A
   107533104 (GABRB1)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 107533104
NCBI-ProteinID: XP_016063177
LinkDB
Position
Unknown
AA seq 406 aa
MWTVQKRGRLGLLSLPAVIAMVCCAHSANEPSNMSYVKETVDRLLKGYDIRLRPDFGGPP
VDVGMRIDVASIDMVSEVNMDYTLTMYFQQSWKDKRLSYSGIPLNLTLDNRVADQLWVPD
TYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIE
SYGYTTDDIEFYWNGGEGAVTGVNKIELPQFSIVDYKMVSKKVEFTTGSYPRLSLSFRLK
RNIGYFILQTYMPSTLITILSWVSFWINYDASAARVALGITTVLTMTTISTHLRETLPKI
PYVKAIDIYLMGCFVFVFLALLEYAFVNYIFFGKGPQKKGAGKQNQSANDKNKLEVNKVQ
LRRRASQLKVKIPDLTDVNSIDKWSRMFFPITFSLFNVVYWLYYVH
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgtggacagtgcaaaagcgagggaggctggggctcctctccctcccggcggtgattgcc
atggtctgttgtgcgcacagcgccaatgagcccagcaacatgtcatacgtgaaagagaca
gtggacagattgctcaaaggatatgacattcgcttgcggccggactttggaggtcccccc
gtggacgtcgggatgcggatcgatgtcgccagcatagacatggtctccgaagtgaacatg
gattatacactcaccatgtatttccagcagtcttggaaagacaaaagactttcttattct
ggaatcccgctaaacctcactctagacaacagggtagctgaccaactctgggtaccagac
acgtactttctgaatgacaagaaatcattcgtgcatggagttacagtgaaaaaccgcatg
atccggctgcatcctgacggaacagttctctatgggctccgaatcacaaccacagctgcg
tgtatgatggatctacggagatatcctctggatgaacaaaactgcactctggagattgaa
agctatggctataccactgatgacattgagttttactggaatggaggagagggagcagta
acaggagtaaataaaattgagcttcctcagttttcaattgtcgactacaagatggtatcc
aagaaggtggagttcacaactggttcatatccacgactgtcactaagttttcgtctaaag
agaaacattggttacttcattttgcagacctatatgccttccacgctgattacgattctg
tcctgggtgtctttttggatcaactatgatgcgtctgcagccagagtcgcactaggaatc
accacggtgctgacaatgacaaccatcagcactcacctcagggagaccctgccaaagatc
ccttatgtcaaagcgattgatatttacctgatgggttgctttgtgtttgtgttcctggct
ctgctggaatatgccttcgtaaattacatcttcttcggaaaaggccctcagaaaaaggga
gctggcaaacagaaccagagcgccaatgacaagaacaaactggaggtgaataaagtccag
ctccgccggcgcgcctcgcagctcaaggtcaagatccccgacctcacggacgtgaactcc
atagacaagtggtcccgaatgtttttccccatcaccttttcccttttcaacgtcgtttac
tggctttactatgtacactaa

KEGG   Miniopterus natalensis: 107533430
Entry
107533430         CDS       T05883                                 

Gene name
GABRR1
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit rho-1
  KO
K05190  gamma-aminobutyric acid receptor subunit rho
Organism
mna  Miniopterus natalensis
Pathway
mna04080  Neuroactive ligand-receptor interaction
mna04723  Retrograde endocannabinoid signaling
mna04727  GABAergic synapse
mna05032  Morphine addiction
mna05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107533430 (GABRR1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107533430 (GABRR1)
   04723 Retrograde endocannabinoid signaling
    107533430 (GABRR1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107533430 (GABRR1)
   05033 Nicotine addiction
    107533430 (GABRR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107533430 (GABRR1)
Ion channels [BR:mna04040]
 Ligand-gated channels
  GABA-A
   107533430 (GABRR1)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 107533430
NCBI-ProteinID: XP_016063600
LinkDB
Position
Unknown
AA seq 392 aa
MRPGFGGPAIPVGVDVQVESLDSISEVDMDFTMTLYLRHYWKDERLSFPSTNNLSMTFDG
RLVKRIWVPDMFFVHSKRSFIHDTTTDNVMLRVQPDGKVLYSLRVTVTAMCNMDFSRFPL
DTQTCSLEIESYAYTEDDLMLYWKKGNESLKTDERISLSQFLIQEFHTTTKLAFYSSTGW
YNRLYINFTLRRHIFFFLLQTYFPATLMVMLSWVSFWIDRRAVPARVPLGITTVLTMSTI
ITGVNASMPRVSYVKAVDVYLWVSFVFVFLSVLEYAAVNYLTTGQERQERRLREQLPCTC
GSPQPRAVLLDSSYGDVEVTDLGNYVPDTGEKPDRVMVQLALASERSSPQRKSRRNSYMS
MRIDTHAIDKYSRIIFPAAYILFNLIYWSIFS
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgaggcccggcttcggaggcccggccattcctgttggagtggatgtgcaggtagaaagc
ttggacagcatctcagaggtagatatggacttcaccatgaccctatacctaaggcactat
tggaaggacgagaggctgtccttcccaagcaccaacaacctcagcatgacgtttgatggc
cggctggtgaagaggatctgggtccccgacatgtttttcgtgcactccaagcgctccttc
atccacgacacgaccacggacaatgtgatgctgcgggtccagcccgacgggaaagtgctt
tacagcctcagggttacagtgaccgccatgtgcaatatggacttcagccgatttcccctg
gacacacagacgtgctctcttgaaattgaaagctatgcctatactgaagatgacctgatg
ctgtactggaaaaagggcaatgaatccttaaagacagatgagaggatctcgctctcccag
ttcctcatccaggaattccacaccaccactaagctggccttctacagcagcacaggctgg
tacaaccgtctgtacattaacttcacgttgcgtcgccacatcttctttttcttgctccaa
acttattttccggctaccctgatggtgatgctgtcctgggtgtccttctggatcgaccgc
agagctgtgcctgccagagtccccttaggaatcaccacggtgctgaccatgtccaccatc
atcacgggcgtgaacgcctccatgccgcgcgtctcctacgtcaaggccgtggacgtctac
ctctgggtgagcttcgtgttcgtgttcctgtcggtgctggagtacgcggccgtcaactac
ctgaccacgggccaggagcggcaggagcggcggctgcgggagcagcttccctgcacctgc
gggtcacctcagccccgcgccgtcctgctggacagcagctatggcgacgtggaggtgacc
gacctgggcaactacgtgccagacaccggcgagaagccagacagggtgatggtgcagctc
gccctggcctcggagaggagctccccgcagaggaaaagtcggaggaacagctacatgagc
atgaggatcgacacccacgccattgacaaatactccaggatcatttttccagcagcctac
attttattcaatttaatatactggtcgattttctcctag

KEGG   Miniopterus natalensis: 107533431
Entry
107533431         CDS       T05883                                 

Gene name
GABRR2
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit rho-2
  KO
K05190  gamma-aminobutyric acid receptor subunit rho
Organism
mna  Miniopterus natalensis
Pathway
mna04080  Neuroactive ligand-receptor interaction
mna04723  Retrograde endocannabinoid signaling
mna04727  GABAergic synapse
mna05032  Morphine addiction
mna05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107533431 (GABRR2)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107533431 (GABRR2)
   04723 Retrograde endocannabinoid signaling
    107533431 (GABRR2)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107533431 (GABRR2)
   05033 Nicotine addiction
    107533431 (GABRR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107533431 (GABRR2)
Ion channels [BR:mna04040]
 Ligand-gated channels
  GABA-A
   107533431 (GABRR2)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 107533431
NCBI-ProteinID: XP_016063601
LinkDB
Position
Unknown
AA seq 465 aa
MPYFTKLILFLFCLMVLVDSRKPKRRRGTGQLEMRKPSHLYKKNPDVTKIRKGKPQQLLR
VEDHDFTMRPAFGGPAIPVGVDVQVESLDSISEVDMDFTMTLYLRHYWKDERLSFSSTSN
KSMTFDGRLVKKIWVPDVFFVHSKRSFIHDTTTDNIMLRVFPDGHVLYSMRITVTAMCNM
DFSHFPLDSQTCSLELESYAYTDEDLMLYWKNGDESLKTDEKISLSQFLIQKFHTTSRLA
FYSSTGWYNRLYINFTLRRHIFFFLLQTYFPATLMVMLSWVSFWIDRRAVPARVSLGITT
VLTMSTIITGVNASMPRVSYVKAVDVYLWVSFVFVFLSVLEYAAVNYLTTVQERQERKLR
EKFPCMCGMLPSRTMMLDGSYSESEANSLAGYPRSHILTEEERQDKIVVHLALSNESNSS
RKKGLLKGQVGLRIFQNTHAIDKYSRLIFPASYIFFNLVYWSVFS
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgccttattttacaaaactcattttgttcttgttttgcctgatggttcttgtggacagc
agaaagcccaagaggaggagagggacagggcagctggaaatgcgcaagccaagccacctt
tataagaagaatccggatgtgaccaaaatccggaaaggaaaacctcagcagctgctcaga
gtggaggaccacgatttcaccatgaggcctgcctttggaggccctgccatcccggtgggt
gtagatgtgcaggtggagagcctggacagcatctcggaggtggacatggacttcactatg
accctgtatctgcggcattactggaaggacgagaggctgtccttcagcagcaccagcaac
aagagcatgacctttgatggccggctggtaaagaagatctgggtccccgatgtcttcttt
gttcactccaaaaggtcattcatccatgacaccaccaccgataacatcatgctgcgggtg
ttcccggatgggcacgtgctgtacagcatgaggattacggtcactgccatgtgcaacatg
gacttcagccactttcccctggactcccagacctgttctttggagctggaaagctatgca
tatacagatgaagatctgatgctgtattggaagaatggggacgaatccctgaaaacagac
gagaagatctccctgtctcagtttctaattcagaaatttcacaccacttccagactggcc
ttctatagcagcactggctggtacaaccgtctgtacattaacttcacgctgcgtcgccac
atcttcttcttcctgctccaaacctatttccctgccaccctgatggtcatgctgtcctgg
gtgtccttctggatcgaccgcagagctgtgcctgccagagtgtcactgggaatcaccacg
gtgctgaccatgtccaccatcatcacgggcgtgaacgcctccatgccgcgcgtctcctac
gtcaaggccgtggacgtctacctctgggtgagcttcgtgttcgtgttcctgtcggtgctg
gagtacgcggccgtcaactacctgaccacggtgcaggagcggcaggagcggaagctgcgg
gagaagttcccgtgtatgtgtggaatgcttccctcaagaaccatgatgctggatggaagc
tacagtgagtctgaggccaacagcttggctggatacccgagaagccatattctgacagaa
gaagagagacaagacaaaatagtggtccacctggccctgagcaatgaatccaattcctcc
aggaagaaggggcttctgaagggccaggtgggtcttcgcatcttccagaacacccacgcc
attgacaaatactccaggttgatattccctgcctcctacatatttttcaacctagtttat
tggtcagtgttttcctag

KEGG   Miniopterus natalensis: 107537858
Entry
107537858         CDS       T05883                                 

Gene name
GABRA6
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit alpha-6
  KO
K05175  gamma-aminobutyric acid receptor subunit alpha
Organism
mna  Miniopterus natalensis
Pathway
mna04080  Neuroactive ligand-receptor interaction
mna04723  Retrograde endocannabinoid signaling
mna04727  GABAergic synapse
mna04742  Taste transduction
mna05032  Morphine addiction
mna05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107537858 (GABRA6)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107537858 (GABRA6)
   04723 Retrograde endocannabinoid signaling
    107537858 (GABRA6)
  09157 Sensory system
   04742 Taste transduction
    107537858 (GABRA6)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107537858 (GABRA6)
   05033 Nicotine addiction
    107537858 (GABRA6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107537858 (GABRA6)
Ion channels [BR:mna04040]
 Ligand-gated channels
  GABA-A
   107537858 (GABRA6)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb CytochromB561_N DUF4396
Other DBs
NCBI-GeneID: 107537858
NCBI-ProteinID: XP_016069470
LinkDB
Position
Unknown
AA seq 453 aa
MASPLPWLYVILWVGHALGALGDEGNAYSENISRILDNLLEGYDNRLRPGFGGAVTEVKT
DIYVTSFGPVSDVEMEYTMDVFFRQTWTDERLKFGGPTEILSLNNLMVSKIWTPDTFFRN
GKRSIAHNMTTPNKLFRIMQNGTILYTMRLTINADCPMRLVNFPMDGHACPLKFGSYAYP
KSEIIYTWKKGPLYSVEVPEESSSLLQYDLIGQTVSSETIKSNTGEYVIMTVYFHLQRKM
GYFMIQIYTPCIMTVILSQVSFWINKESVPARTVFGITTVLTMTTLSISARHSLPKVSYA
TAMDWFIAVCFAFVFSALIEFAAVNYFTNLQTQKAKRKAPGAASPAAGTPKATEPVEAEI
VLHPDSKYYLKRRVTSLTLPIVPCPEAGRVLTRAPILQSAPATPPPLPPAFGGTSKIDQY
SRILFPVAFAGFNLVYWIVYLSKDPMEVSSSVA
NT seq 1362 nt   +upstreamnt  +downstreamnt
atggcatcgcctctgccctggctctacgtgatcttatgggtaggacacgccctaggggca
cttggggatgaaggaaacgcctactcagagaatatcagtcggatcctggacaacttgctt
gaaggctacgacaatcggctgcggccgggattcggaggtgctgtcactgaagtcaaaaca
gacatttacgtgaccagttttgggcccgtgtcagatgtggagatggagtataccatggat
gttttcttccgccagacttggactgatgagaggctgaagtttggggggccaactgagatt
ctgagtttgaataacctgatggtcagtaaaatctggacacctgacacttttttcaggaat
ggcaaaagatcaattgctcacaatatgacaactcctaataaactcttcagaataatgcag
aacggaaccattctatataccatgaggcttaccatcaatgccgactgtccgatgaggctg
gttaactttcctatggatgggcacgcttgcccactcaagtttggaagttatgcctacccc
aaaagtgaaatcatatatacatggaaaaaaggaccactttactcagtcgaagttccagaa
gaatcttcaagcctcctccagtatgatctgattggacaaacagtatctagtgagacgatt
aaatctaatacaggtgaatacgtaataatgacagtctatttccacttgcaacggaagatg
ggctacttcatgatacagatatacacaccctgcatcatgaccgtcattctttcccaggtg
tccttctggatcaataaggagtccgtccccgccaggaccgtctttgggatcaccacggtg
ctgaccatgaccacgctgagcatcagcgcccgccactcgctgcccaaggtgtcctacgcg
accgccatggactggttcatcgccgtgtgctttgccttcgtcttctcggctctcatcgag
ttcgcagctgtcaactacttcaccaacctccagacgcagaaggccaaaaggaaggcgccg
ggggcagcctcgcccgccgcggggacacccaaggccactgagcccgtggaagctgagatt
gtcttgcatcctgactccaagtactacctgaagagaagagtcacctccctgaccttgccg
atagtcccgtgccctgaagccggcagagtcctcactagagctcccatcctacagtcagcg
cccgccacgcccccacccctccctccggcctttgggggcaccagtaaaatcgaccagtac
tctcggattctctttcccgtcgcttttgcaggcttcaatcttgtatactggattgtttat
ctctccaaagacccaatggaagtgagcagcagtgttgcatag

KEGG   Miniopterus natalensis: 107537863
Entry
107537863         CDS       T05883                                 

Gene name
GABRG2
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit gamma-2 isoform X1
  KO
K05186  gamma-aminobutyric acid receptor subunit gamma
Organism
mna  Miniopterus natalensis
Pathway
mna04080  Neuroactive ligand-receptor interaction
mna04723  Retrograde endocannabinoid signaling
mna04727  GABAergic synapse
mna05032  Morphine addiction
mna05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107537863 (GABRG2)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107537863 (GABRG2)
   04723 Retrograde endocannabinoid signaling
    107537863 (GABRG2)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107537863 (GABRG2)
   05033 Nicotine addiction
    107537863 (GABRG2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107537863 (GABRG2)
Ion channels [BR:mna04040]
 Ligand-gated channels
  GABA-A
   107537863 (GABRG2)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 107537863
NCBI-ProteinID: XP_016069475
LinkDB
Position
Unknown
AA seq 513 aa
MSSPNTWSTGSSVYWTPVFSQKMTLWILLLLTLCPGLTRQKSDDDYEDYSSNKTWVLTPK
VPEGDVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVNSIGPVNAINMEYTIDIFFAQT
WYDRRLKFNSTIKVLRLNSNMVGKIWIPDTFFRNSKKADAHWITTPNRMLRIWNDGRVLY
TLRLTIDAECQLQLHNFPMDEHSCPLEFSSCNHNFTSLSTFSVSFPGRNMLRMFTYNHFK
RVLSHLVADGYPREEIVYQWKRNSVEVGDTRSWRLYQFSFVGLRNTTDIVKTTSGDYVVM
CVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIA
RKSLPKVSYVTAMDLFVSVCFIFVFSALVEYGTLHYFVSNRKPSKDKDKKKKNPLLRMFS
FKAPTIDIRPRSATIQMNNATHLQERDEEYGYECLDGKDCASFFCCFEDCRTGAWRHGRI
HIRIAKMDSYARIFFPTAFCLFNLVYWVSYLYL
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgagttcgccaaatacatggagcacaggaagctccgtctactggactcctgtattttca
cagaaaatgacgctgtggatcctgctcctgctaaccctctgcccaggccttactagacaa
aaatctgatgatgactatgaagattattcttcaaacaaaacatgggtcttgacaccaaaa
gttcctgagggcgatgtcactgtcatcttaaacaacctcctagaaggctacgacaataaa
ctccgccctgatataggagtgaaaccgacgttaatccacacagacatgtatgtgaacagc
atcggcccggtgaacgctatcaatatggaatatacaattgatatattttttgcccaaaca
tggtacgacagacgtttgaaattcaacagcaccattaaagtcctccgactgaacagcaac
atggtggggaaaatctggattccagacactttcttcagaaattcgaaaaaggcggatgca
cattggataaccacccccaataggatgctgagaatttggaatgatggtcgagtgctctac
accttaaggttgacaattgatgctgagtgccagttacagctgcacaactttccaatggat
gagcactcctgccccttggagttctccagttgtaatcataactttacctctctcagcacc
ttctcagtgtcttttcctggaaggaacatgctacgtatgttcacttataaccattttaaa
cgtgtgctctcccatctcgtggcagatggctatccacgggaagaaatcgtctatcaatgg
aagcgtaattctgttgaagtgggcgacacaagatcttggaggctgtatcaattttcattt
gttggactgagaaataccactgacatagtgaagacaacttctggagattacgtggtcatg
tgtgtctactttgacctgagcagaagaatgggctacttcaccatccagacctacatcccc
tgtacactcattgttgttctatcctgggtgtctttctggatcaataaggatgctgtgcca
gccagaacttctttaggtatcacgacagtcctgacaatgacgaccctcagcaccattgcc
cggaagtcactccccaaggtctcctatgtcacagcaatggatctctttgtatctgtctgc
ttcatatttgtcttctctgcgctggtggagtatggcaccctgcactattttgtcagcaat
cggaaaccaagcaaggacaaagataaaaagaagaaaaaccctcttcttcggatgttttcc
ttcaaggccccaacgattgatattcggccaagatcagccaccattcaaatgaacaatgcc
acgcaccttcaagagcgagacgaagaatatgggtacgagtgcctggacggcaaggactgt
gccagctttttctgctgttttgaagactgccggacaggagcttggagacatgggcggata
cacatccgaatcgccaaaatggactcgtacgcgcgcatcttctttcccacggccttctgc
ttgttcaatctggtgtactgggtctcctacctttacctgtaa

KEGG   Miniopterus natalensis: 107537880
Entry
107537880         CDS       T05883                                 

Gene name
GABRB2
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit beta-2 isoform X1
  KO
K05181  gamma-aminobutyric acid receptor subunit beta
Organism
mna  Miniopterus natalensis
Pathway
mna04080  Neuroactive ligand-receptor interaction
mna04723  Retrograde endocannabinoid signaling
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna05032  Morphine addiction
mna05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107537880 (GABRB2)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107537880 (GABRB2)
   04726 Serotonergic synapse
    107537880 (GABRB2)
   04723 Retrograde endocannabinoid signaling
    107537880 (GABRB2)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107537880 (GABRB2)
   05033 Nicotine addiction
    107537880 (GABRB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107537880 (GABRB2)
Ion channels [BR:mna04040]
 Ligand-gated channels
  GABA-A
   107537880 (GABRB2)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 107537880
NCBI-ProteinID: XP_016069493
LinkDB
Position
Unknown
AA seq 498 aa
MWRERKKGYLGIWPFPLLIAAVCAQSVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPV
AVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDT
YFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIES
YGYTTDDIEFYWRGDDNAVTGVKKIELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKR
NIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIP
YVKAIDMYLMGCFVFVFMALLEYALVNYIFFGRGPQRQKKAAEKAASANSDKMRLDVNKP
GKTSSGVYLQEAHHPYLFQTYGKMDPHENILLSTLEIKNEMATSEAVMGLGDPRSTMLAY
DASNIQYRKAGLPRHTFGRNALERHVAQKKSRLRRRASQLKITIPDLTDVNAIDRWSRIF
FPVVFSFFNIVYWLYYVN
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgtggagagagcggaaaaaaggctaccttgggatctggccgttccccctgctgatcgcc
gcggtctgcgcgcagagtgtcaatgatcctagtaatatgtccctggttaaagagacggtg
gatagactcctgaaaggctatgacattcgcctgagaccagattttggaggtccccccgtg
gccgtgggaatgaatattgacattgccagcatcgatatggtttctgaagtcaatatggat
tataccttgacaatgtattttcaacaagcctggagagacaagaggctgtcctataatgtc
atacctttaaacttaactctggacaatcgagtagcagaccagctgtgggtgcccgacacc
tacttcctgaacgacaagaagtcgtttgtgcacggggtgaccgtcaaaaaccgcatgatc
cgcctgcaccccgacggcaccgtcctctacggcctcagaatcacaaccacagccgcctgc
atgatggacctgcggcggtacccgctggacgagcagaactgcaccttggaaatcgaaagc
tacggatatacaaccgatgacattgagttttactggcgtggggacgataacgcagtaaca
ggagtaaaaaagattgaacttccacagttctccatcgtagattacaaactcatcaccaag
aaggtggtcttctccacaggttcctatcccaggttgtccctcagtttcaagctgaagaga
aacattggttacttcatcctgcagacctacatgccttccatcctgatcactatcctctcc
tgggtctccttctggattaattacgacgcctcggctgcccgagtggcattgggaattaca
actgtccttacaatgaccaccatcaacacccacctccgggagactctccctaaaatcccc
tacgtgaaggccattgacatgtacctgatggggtgctttgtctttgttttcatggccctt
ctggaatatgctttggtcaactacatcttctttgggaggggaccccaacgccaaaagaaa
gcagccgagaaggctgcgagcgccaacagcgataagatgcgcctggatgtgaacaagcct
gggaagacctccagtggtgtttacctacaggaagctcatcacccatatctattccagact
tacggcaagatggacccccatgagaacatcttactcagcactcttgagataaaaaatgaa
atggccacatctgaggctgtgatgggacttggagaccccaggagcacaatgctggcttat
gatgcctccaacatccagtatcggaaagccgggctgcccaggcatacttttggccgaaat
gccctggagcgacacgtggcccagaagaaaagccgcctgcggagacgcgcgtcccaactg
aaaatcaccatccccgacttgactgatgtgaatgccatagatcggtggtcacgcatattc
ttccccgtggttttttccttcttcaacatcgtctactggctctactatgtgaactaa

KEGG   Miniopterus natalensis: 107537889
Entry
107537889         CDS       T05883                                 

Gene name
GABRA1
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit alpha-1
  KO
K05175  gamma-aminobutyric acid receptor subunit alpha
Organism
mna  Miniopterus natalensis
Pathway
mna04080  Neuroactive ligand-receptor interaction
mna04723  Retrograde endocannabinoid signaling
mna04727  GABAergic synapse
mna04742  Taste transduction
mna05032  Morphine addiction
mna05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107537889 (GABRA1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107537889 (GABRA1)
   04723 Retrograde endocannabinoid signaling
    107537889 (GABRA1)
  09157 Sensory system
   04742 Taste transduction
    107537889 (GABRA1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107537889 (GABRA1)
   05033 Nicotine addiction
    107537889 (GABRA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107537889 (GABRA1)
Ion channels [BR:mna04040]
 Ligand-gated channels
  GABA-A
   107537889 (GABRA1)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 107537889
NCBI-ProteinID: XP_016069505
LinkDB
Position
Unknown
AA seq 457 aa
MRKKSRGLPDCLWAWTLLLSTLTGRSYGQPSLQDELKDNTTVFTRILDRLLDGYDNRLRP
GLGERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLKFKGPMTVLRLNNLMAS
KIWTPDTFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTMRLTVRAECPMHLEDFPMDAHA
CPLKFGSYAYTRAEVVYEWTREPARSVVVAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVV
MTTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSIS
ARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGYAWDGKSVVPEKPKKVKD
PLIKKNNTYAPTATSYTPNMARGDPGLATIAKSATIEPKEVKPEAKPPEPKKTFNSVSKI
DRLSRIAFPLLFGIFNLVYWATYLNREPQLKAPTPHQ
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgaggaagaagagccggggtctccctgactgcctctgggcctggaccctccttctcagc
acactgactggaagaagctatggacaaccctcattacaggatgaacttaaagacaatacc
actgtcttcaccaggattttggaccgactcctagatggttatgacaatcgcctaagacca
ggattgggagagcgtgtaactgaagtgaagactgacatcttcgtcaccagtttcggaccc
gtttcagaccatgatatggaatacacaatcgatgtatttttccgtcaaagctggaaggac
gaaaggttaaaatttaaaggaccaatgacagttctccggttaaataacctaatggcaagt
aagatctggactccggacaccttttttcacaatggaaagaagtcagtggcacataacatg
accatgcccaacaaactcctgaggatcacagaggatggcaccttgctgtacaccatgagg
ctgacagtgagagctgaatgtccgatgcatttggaggatttccctatggatgcccatgcc
tgcccactaaaatttggaagctatgcttatacgagagcagaagttgtttatgagtggacc
agggagccagcgcgctccgtggtggtagcagaagatgggtcacgcctcaaccagtatgat
cttcttggacaaacagtagactctggaattgttcagtccagcacaggagaatatgttgtt
atgaccactcatttccacctgaaaagaaagattggctattttgtcattcaaacatatctg
ccatgcataatgaccgtcattctgtcccaagtctccttctggctcaacagagagtctgta
ccagcgaggacagtctttggagtcacgactgtgctcaccatgacgacgctgagcatcagc
gccagaaactcgctgcccaaggtggcgtacgccactgcgatggactggttcatcgccgtg
tgctacgccttcgtgttctcagccctcatcgagtttgccaccgtgaactacttcaccaag
cggggctacgcctgggatggcaaaagtgtggtcccagaaaagccaaagaaagtgaaggac
cctcttattaagaaaaacaacacttatgctccgacagcaaccagttacacccctaacatg
gccaggggtgacccgggcttagccaccattgctaaaagtgcaaccatagaaccaaaagaa
gtcaagccggaggcaaaacctccggaacccaagaaaacctttaacagcgtcagcaaaatt
gaccggctgtcaagaatagcgttcccgctgctgttcgggatctttaacttggtctactgg
gccacgtacctaaacagagagcctcagctcaaagcccccaccccccaccagtag

KEGG   Miniopterus natalensis: 107537955
Entry
107537955         CDS       T05883                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: gamma-aminobutyric acid receptor subunit epsilon-like
  KO
K05185  gamma-aminobutyric acid receptor subunit epsilon
Organism
mna  Miniopterus natalensis
Pathway
mna04080  Neuroactive ligand-receptor interaction
mna04723  Retrograde endocannabinoid signaling
mna04727  GABAergic synapse
mna05032  Morphine addiction
mna05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107537955
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107537955
   04723 Retrograde endocannabinoid signaling
    107537955
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107537955
   05033 Nicotine addiction
    107537955
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107537955
Ion channels [BR:mna04040]
 Ligand-gated channels
  GABA-A
   107537955
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 107537955
NCBI-ProteinID: XP_016069563
LinkDB
Position
Unknown
AA seq 379 aa
MLTKVLLILLDMSIILPSRIERPHVESEMGPSAGHDDVYGPKPQDAKKKVPSEEIRPATI
DTHQNLGKLPAASQILDSILNNSDYKLHPGIDKKPTVATVDLILDPISILKRKYSIDITL
CQTWYDELFINNGSFENLVLNGNMVSQLWNPDSFFRNSKWTLVYEITMPNQVVHIHKDGK
ALYTIRVTTDTGCSFHMLKFPMDSHFCPLSFSSFSYPENEMMYKWKDFKLEINESNSWKL
FQFNFTGVSNETETISTIAGNDLMIIMLFFNVSRLFGLNAIQNYVPSSVTVIMFWVSFWI
KKDSVPAKTSLRITSVLPMTTLGSYSQKNFLHVSYITALDFCIAICFLFCLCTLVEFAML
NFLIYNHTEPGSSLRLHHI
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgttgaccaaagttctcctgatcctcctggacatgtccataatcctgccttctaggatt
gaaagacctcatgttgaatcggagatgggaccctctgctggtcatgatgatgtctatggc
cctaagccccaggatgccaaaaagaaggtcccctctgaagaaataaggcccgctactatt
gatactcaccaaaaccttggaaaactaccagcagcctctcaaatcctggacagtatcctg
aataactctgattataaactgcaccctggcattgacaagaagcccactgtggccactgtt
gatcttatccttgatcctatctctatcctgaagaggaagtactccattgacatcaccttg
tgccagacctggtatgatgaactcttcattaacaatggcagctttgagaacttagttctg
aatggcaacatggtgagccagttatggaacccagacagtttttttaggaattctaagtgg
actcttgtatatgaaatcactatgccaaaccaggtggtccacatccacaaggatggcaag
gcgttgtacacaattagggtgaccactgatactggatgttcattccacatgctcaaattt
ccaatggattctcatttttgccctctgtctttttctagtttttcctatcctgagaatgag
atgatgtacaagtggaaagatttcaagcttgaaatcaatgagagtaattcctggaagctc
ttccagtttaattttacaggagtgagcaatgagactgaaactatctcaaccatagctggt
aatgatttaatgattatcatgcttttcttcaatgtgagcaggttgtttggcttaaatgcc
attcaaaactatgtcccttcttctgtgacagtgatcatgttctgggtttccttttggatc
aagaaggactctgttccagccaagacttctttaagaatcacctctgttctccccatgacc
acattgggttcttattcccagaagaatttcctacatgtctcctacattacagccttggat
ttctgtattgccatctgtttcctcttctgcctctgtactctggtggagttcgctatgctt
aacttcctgatctacaaccacacggaacccggttcttctctgaggcttcaccatatatga

KEGG   Miniopterus natalensis: 107537964
Entry
107537964         CDS       T05883                                 

Gene name
GABRQ
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit theta
  KO
K05192  gamma-aminobutyric acid receptor subunit theta
Organism
mna  Miniopterus natalensis
Pathway
mna04080  Neuroactive ligand-receptor interaction
mna04723  Retrograde endocannabinoid signaling
mna04727  GABAergic synapse
mna05032  Morphine addiction
mna05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107537964 (GABRQ)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107537964 (GABRQ)
   04723 Retrograde endocannabinoid signaling
    107537964 (GABRQ)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107537964 (GABRQ)
   05033 Nicotine addiction
    107537964 (GABRQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107537964 (GABRQ)
Ion channels [BR:mna04040]
 Ligand-gated channels
  GABA-A
   107537964 (GABRQ)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 107537964
NCBI-ProteinID: XP_016069569
LinkDB
Position
Unknown
AA seq 702 aa
MGIRGMLRAAVLLLLIRTWLSEGNNATPLPEFHLELSSTVPEVVQNVFNCKNCASEAVVH
KILDRVLSGYDAHLRPHFGGEPVPVGISMYVSSIEHISEITMDCTVTMFFHQTWKDPCLA
YCETHLNLTLDYRMVEKLWVPDFYFLNSKDGFVHDMTVKNLMFQLHPDGTVQDGIQLITT
AACSMNLQKYPMDKQTCKLEVESYGYTVEDNILYWEGDKNAIQGTEKLHIPQFTLLGKIM
TNKEEIFYTGSYVRLILRFLIQRKIINYLVQIYWPTILTTIASWITFWMNYESSVTRVTV
GLTEMLILNALNSHLRENLPEFSCIKAIDIYTVVCFFFVFLSLLEYVYVNYLFYSRVGTH
YHYRQRGRAQRIVGHYHYQESRLQPQAYQRTQEEEILSVKEINNHFTSADEEGPLPAPFP
KVLIHVGFESTDFISLSAVSSKDNQVNIKNESGSPPFRPVQAHSSIPESLNSLTFISEQV
PLATSESLSSLSSLSVQSWLATGESLSDLSSTSEQALHSYDIHFNGFEIDGSVIPTKIHN
HGEAHGHAEIHDPEDPEESYSLDNNHGHGPNRKCLLIRGQKCVQEESCRPDIIHIRCEVF
LSLPGDIKVDRGYLDLKKQLQHDSHTIWSHNGDSFMGFDQDEDSNSESDDSCPPNPGYSF
RERFCYELFDPDYVPKVDKWSRILFPLAFVVFNIIYWPYNGF
NT seq 2109 nt   +upstreamnt  +downstreamnt
atgggcatccgagggatgctgcgagccgctgtgctcctgctgctcatcaggacatggctc
tcggagggcaacaacgcaactcccctcccggaattccacttggagctctcttctaccgtg
cccgaagtcgtccagaatgtcttcaattgcaaaaattgtgcaagtgaagctgtggttcac
aagattttggacagggtgctgtcaggatatgatgcccatctgagaccacattttggaggc
gaacctgtgcctgtgggaatatctatgtatgtctccagtattgaacacatctcagaaata
actatggactgtactgtcacaatgttttttcatcaaacttggaaagatccatgtttagca
tactgtgagacccacctgaatctgactctggactatcgcatggttgagaagttgtgggtc
cctgacttctactttctaaatagcaaggatggcttcgtgcatgacatgactgtgaaaaat
cttatgtttcagcttcacccagatggaacggtgcaggatggcatccaactcatcaccaca
gcagcttgctctatgaatctacagaaataccctatggacaagcagacctgcaagctggag
gtggaaagttatggctacacggttgaagacaacattttatactgggaaggtgataagaat
gccatccaggggactgagaagctacacatccctcagttcacccttttgggaaagataatg
actaacaaagaggagattttctacacaggttcctatgtgcgacttatactgagattcttg
atccagaggaaaattataaactaccttgtgcagatttattggcctactatcctcaccact
attgcctcttggataacgttttggatgaactatgaatcttctgtaaccagggtgacagtc
ggtctgactgaaatgctcatcctgaacgccctcaattcacacctgcgggaaaacctcccc
gaattttcttgtatcaaggccattgacatttatacggttgtatgctttttcttcgtgttt
ctgtccttgctggaatatgtgtacgtcaactatcttttctacagccgagtgggaactcac
taccattataggcaacgtgggagagcccaaagaatcgtaggccactatcactaccaggaa
tcaaggttgcagccccaggcataccaaagaacccaggaagaggagattctgtcagtcaaa
gagatcaacaatcactttacaagtgctgatgaagaaggaccccttcctgctccttttccg
aaagtgcttattcatgtaggatttgaatctactgacttcataagtttatcggctgtttct
tcaaaggataaccaagttaacatcaaaaatgaaagtggctctcctccctttagaccagtg
caggcccactcatctatcccagaaagcctcaactctttgaccttcatctcagagcaggtc
ccactggccacctcagaaagccttagctcactgtcttctctctcagtccagtcctggctg
gccacaggagaaagcctgagtgatctctcctccacctcagagcaagccctgcacagctat
gacattcattttaatggttttgagattgatggcagtgttattcctaccaaaatccacaat
catggtgaagcccatggccatgctgagatacatgacccagaagaccctgaagagagctac
agcttggataacaaccatggtcatggccccaatagaaagtgtctgctcatccgtggccag
aagtgtgtgcaagaagaaagctgcaggcctgatatcatccatatacgctgtgaagtgttc
cttagcttgcctggtgacatcaaagttgatcgcggttacctcgaccttaagaagcaactt
cagcatgatagtcacactatctggagccataatggtgacagtttcatgggctttgatcaa
gacgaggacagtaattcagaatctgatgatagttgccccccaaaccctgggtactctttc
agggaaaggttttgttacgagctctttgaccctgactatgtccctaaggttgataagtgg
tcccggatcctcttccctcttgcctttgtggtgttcaacattatttactggccatacaat
ggcttttag

KEGG   Miniopterus natalensis: 107537965
Entry
107537965         CDS       T05883                                 

Gene name
GABRA3
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit alpha-3 isoform X1
  KO
K05175  gamma-aminobutyric acid receptor subunit alpha
Organism
mna  Miniopterus natalensis
Pathway
mna04080  Neuroactive ligand-receptor interaction
mna04723  Retrograde endocannabinoid signaling
mna04727  GABAergic synapse
mna04742  Taste transduction
mna05032  Morphine addiction
mna05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107537965 (GABRA3)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107537965 (GABRA3)
   04723 Retrograde endocannabinoid signaling
    107537965 (GABRA3)
  09157 Sensory system
   04742 Taste transduction
    107537965 (GABRA3)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107537965 (GABRA3)
   05033 Nicotine addiction
    107537965 (GABRA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107537965 (GABRA3)
Ion channels [BR:mna04040]
 Ligand-gated channels
  GABA-A
   107537965 (GABRA3)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 107537965
NCBI-ProteinID: XP_016069570
LinkDB
Position
Unknown
AA seq 492 aa
MIITQLSHFYMTGLGLLFLINILPETTGQGESRRQEPGDFVKQDLGGLSPKHAPDIPDDS
TENITIFTRILDRLLDGYDNRLRPGLGDAVTEVKTDIYVTSFGPVSDTDMEYTIDVFFRQ
TWHDERLKFDGPMKILPLNNLLASKIWTPDTFFHNGKKSVAHNMTTPNKLLRLVDNGTLL
YTMRLTIHAECPMHLEDFPMDVHACPLKFGSYAYTKAEVVYSWTLGKNKSVEVAQDGSRL
NQYDLLGHVVGTDIIRSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLN
RESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVN
YFTKRSWAWEGKKVPEALEMKKKTPAAPTKKTSTTFNIVGTTYPINLAKDTEFSTISQGT
VPSASSTPTIIASPKTTYVQDIPTETKTYNSVSKVDKISRIIFPVLFAIFNLVYWATYVN
RESAIKGMIRKQ
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgataatcacacaattgagtcacttctacatgactggccttgggcttcttttcctgatt
aatattctccctgaaacaactggtcaaggggaatcaagacgacaagagcctggggatttt
gtgaagcaagatttaggcggactctctcccaagcatgccccagatattcctgatgacagc
actgaaaacatcactatcttcaccagaatcttagatcgtctcctggatggctatgacaac
cggctgcgacctgggcttggagatgctgtgactgaagtgaagactgatatctacgtgacc
agttttggccctgtgtcagacactgatatggagtataccattgatgtattttttcgacag
acatggcatgatgaaagactaaaatttgatggacccatgaagatccttccactaaacaat
cttctggctagtaagatctggacccctgacaccttctttcacaatggcaagaaatcggtg
gcccataacatgaccacgcctaacaagttgctcagactggtagacaatggaaccctcctc
tacacaatgaggttaacaattcatgctgagtgtcccatgcatttggaagattttcccatg
gatgtgcatgcctgcccactgaagtttggaagctatgcctatacaaaagctgaagtggtt
tattcttggactcttgggaagaacaaatctgtggaagtagcacaggatggctctcgcctg
aatcaatatgacctgctgggccatgttgttgggacagatataatccgctccagtacagga
gaatatgtcgtcatgacaacccacttccatctcaagagaaaaattggctactttgtgatc
cagacctacttgccatgtattatgactgtcattctgtcacaggtgtctttctggctcaac
agagaatctgtccctgcccgcacagtctttggtgtcaccactgttctcaccatgaccacc
ctgagtatcagtgccagaaactctttacctaaagtggcatacgcgacggccatggattgg
ttcatagccgtctgttatgcctttgtattttctgcgctgattgaatttgccactgtcaac
tacttcaccaagcggagttgggcttgggaaggcaagaaggtgccagaggccctggagatg
aagaagaaaacaccagcagctccgacaaaaaaaaccagcaccaccttcaacatcgtgggg
accacctatcccatcaaccttgctaaggacactgagttctccaccatttcccagggcaca
gttcccagtgcctcctcaaccccgactattattgcttcaccgaagaccacctatgtgcag
gacatcccaactgagaccaagacctacaacagtgtcagcaaggttgacaaaatttcccgc
atcatctttcctgtgctctttgccattttcaatctggtctattgggccacatatgtcaac
cgggagtcagctatcaagggcatgatccgcaaacagtag

KEGG   Miniopterus natalensis: 107540159
Entry
107540159         CDS       T05883                                 

Gene name
GABRD
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit delta
  KO
K05184  gamma-aminobutyric acid receptor subunit delta
Organism
mna  Miniopterus natalensis
Pathway
mna04080  Neuroactive ligand-receptor interaction
mna04723  Retrograde endocannabinoid signaling
mna04727  GABAergic synapse
mna05032  Morphine addiction
mna05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107540159 (GABRD)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107540159 (GABRD)
   04723 Retrograde endocannabinoid signaling
    107540159 (GABRD)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107540159 (GABRD)
   05033 Nicotine addiction
    107540159 (GABRD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107540159 (GABRD)
Ion channels [BR:mna04040]
 Ligand-gated channels
  GABA-A
   107540159 (GABRD)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 107540159
NCBI-ProteinID: XP_016072334
LinkDB
Position
Unknown
AA seq 422 aa
MNDIGDYVGSNLEISWLPNLDGLMEGYARNFRPGIGGPPVNVALAIEVASIDHISEVNME
YTMTVFLHQSWRDSRLSYNHTNETLGLDSRFVDKLWLPDTFIVNAKSAWFHDVTVENKLI
RLQPDGVILYSIRITSTVSCDMDLAKYPMDEQECTLHLESYGYSSEDIVYYWSENQEQIH
GLDKLQLAQFTITSYRFTTELMNFKSAGQFPRLSLYFHLRRNRGVYIMQSYMPSILLVAM
SWVSFWISQAAVPARVSLGITTVLTMTTLMVSARSSLPRASAIKALDVYFWICYVFVFAA
LVEYAFAHFNADYRKKRKAKVKVKVTRQRAEMDVKNAIVLFSLSAAGISQELAVSRRPSR
MPGNLMGSYRSVEVETGESEKQGGLRALFKPIDADTIDIYARAVFPAAFAAVNVIYWAAY
TM
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgaatgacattggggactacgtcggctccaacctggagatatcctggctccccaacctg
gacggcctgatggagggctatgcccgaaacttccgtccaggcattggaggcccccctgtg
aacgtggcacttgctattgaggtggccagcatcgaccacatatccgaggtgaacatggag
tacaccatgaccgtgttcctgcaccaaagctggcgggacagcaggctctcctacaaccac
accaacgagaccctgggcctggacagccgctttgtggacaagctctggctcccggacacc
ttcatcgtgaatgccaagtccgcctggttccacgacgtgaccgtggagaacaaactcatc
cggctgcagcccgacggggtgatcctgtacagcatccgaatcacctccactgtgtcgtgt
gacatggacctggccaagtaccccatggacgagcaggagtgcacgctgcacctggagagc
tatggctactcgtccgaggacatcgtctactactggtctgagaaccaggagcagatccac
gggctggacaagctgcagctggcccagttcaccatcaccagctaccgctttaccacggag
ctcatgaacttcaagtcggccggccaattccctcggctcagcctgtacttccaccttcgg
agaaaccgcggtgtgtatatcatgcagtcctacatgccctccattctcctggtcgccatg
tcctgggtctccttctggatcagccaagccgctgtgcccgccagggtgtctctaggcatc
accacggtgctgaccatgaccaccctgatggtcagcgcccgctcctccctcccgcgggcg
tcggccatcaaggccctggacgtgtacttctggatctgctacgtgttcgtgttcgcggcc
ctggtggaatatgccttcgctcacttcaatgccgactaccggaagaagcgaaaggccaag
gtcaaggtcaaggtcacacggcagagggcagagatggacgtgaagaacgccattgtactg
ttctccctctcggccgccggcatctcccaggagctggctgtgtcccgccggccgagccgc
atgcccgggaacctcatgggctcctacaggtcggtggaggtggagacgggggagtccgag
aaacagggaggcctccgtgcccttttcaagcccatcgacgcagacaccatcgacatctac
gcccgcgcagtgttccccgcagccttcgccgctgtcaacgtcatctactgggcggcctac
accatgtga

KEGG   Miniopterus natalensis: 107540343
Entry
107540343         CDS       T05883                                 

Gene name
GABRP
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit pi
  KO
K05189  gamma-aminobutyric acid receptor subunit pi
Organism
mna  Miniopterus natalensis
Pathway
mna04080  Neuroactive ligand-receptor interaction
mna04723  Retrograde endocannabinoid signaling
mna04727  GABAergic synapse
mna05032  Morphine addiction
mna05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107540343 (GABRP)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107540343 (GABRP)
   04723 Retrograde endocannabinoid signaling
    107540343 (GABRP)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107540343 (GABRP)
   05033 Nicotine addiction
    107540343 (GABRP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107540343 (GABRP)
Ion channels [BR:mna04040]
 Ligand-gated channels
  GABA-A
   107540343 (GABRP)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb DUF3060
Other DBs
NCBI-GeneID: 107540343
NCBI-ProteinID: XP_016072565
LinkDB
Position
Unknown
AA seq 440 aa
MRHSLHLTLLYLSLLAGRVCIQGNRFTVEVGRSDKLSLPGFENLTVGYNKFLRPNFGGEP
VQIALTLDIASIYSISESNMDYTATIYLRQRWTDQRLVFEGNKSVTLDARLVEFLWVPDT
YIVESKKSFLHEVTVGNRLIRLFSNGTVLYALRITTTVACNMDLSKYPMDTQTCQLQLES
WGYDGSDVEFSWLRGNDSVRGLENLRLAQYTVQRYFTLVTRSQQETGNYTRLVLQFELRR
NVLYFILETYVPSTFLVVLSWVSFWISLDSVPARTCIGVTTVLSMTTLMIGSRTSLPNTN
CFIKAIDVYLGICFSFVFGALLEYAVAHYSSLQQMAAKDRGVPKEAEEVNIANIINSSIS
SFKRKISFASIEISGDNVDYSNLTMKTSDKFKFVFRDKMGRIVDYFTIQNPSNVDRYSKL
LFPLIFMLANVFYWAYYMYF
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgagacacagtctccacttgactttgctgtatctgagtctcttggctggaagggtgtgt
atccaggggaaccggttcaccgtggaggtcggcagaagcgacaagctctccctgccgggc
tttgagaacctcactgtaggatataacaagtttctcaggcccaattttggcggagagccc
gtccagatagccctgactctggacatcgctagtatttatagtatttcagagagtaacatg
gactacacggccaccatctacctcagacagcgctggacggaccagcggctggtgttcgag
ggcaacaagagtgtcactctggacgcgcgcctcgtggagttcctgtgggtgccggacact
tacattgtggagtccaagaagtccttcctccacgaggtcaccgtgggaaacaggctcatc
cgcctcttctccaacggcacggtcctgtatgctctcagaatcacaacgactgttgcctgt
aacatggacctgtctaaataccccatggacacacagacatgccagttgcaactggaaagc
tggggctacgacggaagcgacgtggagttcagctggctgcgcgggaacgactcggtgcgt
gggctggagaacctgcggctggctcagtacaccgtccaacggtatttcaccctggtcacc
aggtcacagcaggaaacaggaaactatacgcgattggtcctgcaatttgagctccggagg
aacgtcctgtacttcattttggaaacctacgttccttccactttcctcgtggtgctatcc
tgggtttcgttctggatctccctcgattcagtgcctgcgaggacctgcatcggagtgacc
accgtattgtcaatgaccaccctgatgatcgggtcccgcacttctcttcccaacaccaac
tgcttcataaaggccatcgacgtgtacctggggatctgctttagcttcgtgtttggggcg
ctactggaatacgcggttgcccactacagctccttacagcagatggcggccaaagacagg
ggggtgccgaaggaggcagaagaagtcaacatcgccaacatcatcaacagctccatctcc
agctttaaacgcaagatcagctttgcctctattgaaatttctggtgacaacgttgactac
agcaacctgaccatgaaaaccagcgacaagttcaagttcgtcttccgagataagatggga
aggattgttgattacttcacgattcaaaaccccagtaatgttgatcgatactccaaacta
ctatttcctttgatttttatgctagccaatgtattttactgggcatactacatgtatttt
taa

DBGET integrated database retrieval system