KEGG   Miniopterus natalensis: 107527103
Entry
107527103         CDS       T05883                                 

Gene name
GABRR3
Definition
(RefSeq) LOW QUALITY PROTEIN: gamma-aminobutyric acid receptor subunit rho-3
  KO
K05190  gamma-aminobutyric acid receptor subunit rho
Organism
mna  Miniopterus natalensis
Pathway
mna04080  Neuroactive ligand-receptor interaction
mna04723  Retrograde endocannabinoid signaling
mna04727  GABAergic synapse
mna05032  Morphine addiction
mna05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107527103 (GABRR3)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107527103 (GABRR3)
   04723 Retrograde endocannabinoid signaling
    107527103 (GABRR3)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107527103 (GABRR3)
   05033 Nicotine addiction
    107527103 (GABRR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107527103 (GABRR3)
Ion channels [BR:mna04040]
 Ligand-gated channels
  GABA-A
   107527103 (GABRR3)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 107527103
NCBI-ProteinID: XP_016055221
LinkDB
Position
Unknown
AA seq 364 aa
MTFYLRHYWKDERLSFPSTANKSLTCDRRLIRKIWVPATFLGHSKRSFTHDPTVTALPLV
LHAYLAICFDGLRFPFSYSFPRITVSATCFMDFSGFPLDTQNCSLELESHAYNEEDLVLY
XRHRNGSLNTGEHISLPQFFIEESRASGGFASYSSTGWYNRLFINFVLRRRILFFVLRTY
XPWVSFWIHPRAVPAGVSLGVTTVLTMXTTVPGVSASGPRCPASRPCRGPGGGSLSVCLS
PTEFAAGSSLPGAEERERLRKAGRISGMYNIDAVQAMAFDGCHHDSETDMDQTSFSLHPE
YDSIRGRFTGSPSADPSRIERRKPPGGHVGRTILENHHVIDTYSWILFPIVYIIVNLFYW
GTYV
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgactttttatctcaggcattactggaaagatgaaaggctctcctttcctagcacagca
aacaaaagcctcacttgtgatcgtagattgatcagaaagatttgggtgcctgctaccttt
cttggccattctaaaaggtccttcacccacgacccgacggtaacagcgcttcctttagta
ttgcacgcttatttggccatatgcttcgatggcctgcggtttcccttttcttactctttt
cctaggataactgtttccgccacgtgctttatggatttcagcgggtttccccttgacact
cagaattgttcccttgagctggaaagccatgcctacaatgaagaggatctcgtgctgtac
tgaagacatagaaatgggtccttaaatactggtgagcatatttcccttcctcagttcttc
attgaagagtccagggcatccggtggatttgcctcatacagcagcacaggttggtacaat
cggcttttcatcaacttcgtgctgaggaggcgtattctcttctttgtgctgcgaacctat
nntccctgggtttcattttggattcacccaagagctgttcctgcaggagtttccttggga
gtcaccacggtgctgaccatgnccaccaccgtccctggcgtgagcgcctccgggcccagg
tgtcctgcgtcaaggccgtgccgtggacctgggggcggctccctctccgtgtgcctgtca
cccaccgagtttgcagccgggagctccctccccggagcggaggaacgggagcggctcagg
aaggcggggaggatttctggaatgtacaatattgatgcagttcaagctatggccttcgat
ggttgtcaccacgacagcgagactgacatggaccagacttccttttctctccacccagaa
tatgactccattagaggaagattcacaggcagccccagtgcagacccatccaggatagag
agaagaaaacccccgggagggcacgtcggcagaaccattctggagaaccaccatgtcatt
gacacctactcatggattttatttcccattgtgtatattatagttaatttgttttactgg
ggtacatatgtgtga

KEGG   Miniopterus natalensis: 107533430
Entry
107533430         CDS       T05883                                 

Gene name
GABRR1
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit rho-1
  KO
K05190  gamma-aminobutyric acid receptor subunit rho
Organism
mna  Miniopterus natalensis
Pathway
mna04080  Neuroactive ligand-receptor interaction
mna04723  Retrograde endocannabinoid signaling
mna04727  GABAergic synapse
mna05032  Morphine addiction
mna05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107533430 (GABRR1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107533430 (GABRR1)
   04723 Retrograde endocannabinoid signaling
    107533430 (GABRR1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107533430 (GABRR1)
   05033 Nicotine addiction
    107533430 (GABRR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107533430 (GABRR1)
Ion channels [BR:mna04040]
 Ligand-gated channels
  GABA-A
   107533430 (GABRR1)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 107533430
NCBI-ProteinID: XP_016063600
LinkDB
Position
Unknown
AA seq 392 aa
MRPGFGGPAIPVGVDVQVESLDSISEVDMDFTMTLYLRHYWKDERLSFPSTNNLSMTFDG
RLVKRIWVPDMFFVHSKRSFIHDTTTDNVMLRVQPDGKVLYSLRVTVTAMCNMDFSRFPL
DTQTCSLEIESYAYTEDDLMLYWKKGNESLKTDERISLSQFLIQEFHTTTKLAFYSSTGW
YNRLYINFTLRRHIFFFLLQTYFPATLMVMLSWVSFWIDRRAVPARVPLGITTVLTMSTI
ITGVNASMPRVSYVKAVDVYLWVSFVFVFLSVLEYAAVNYLTTGQERQERRLREQLPCTC
GSPQPRAVLLDSSYGDVEVTDLGNYVPDTGEKPDRVMVQLALASERSSPQRKSRRNSYMS
MRIDTHAIDKYSRIIFPAAYILFNLIYWSIFS
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgaggcccggcttcggaggcccggccattcctgttggagtggatgtgcaggtagaaagc
ttggacagcatctcagaggtagatatggacttcaccatgaccctatacctaaggcactat
tggaaggacgagaggctgtccttcccaagcaccaacaacctcagcatgacgtttgatggc
cggctggtgaagaggatctgggtccccgacatgtttttcgtgcactccaagcgctccttc
atccacgacacgaccacggacaatgtgatgctgcgggtccagcccgacgggaaagtgctt
tacagcctcagggttacagtgaccgccatgtgcaatatggacttcagccgatttcccctg
gacacacagacgtgctctcttgaaattgaaagctatgcctatactgaagatgacctgatg
ctgtactggaaaaagggcaatgaatccttaaagacagatgagaggatctcgctctcccag
ttcctcatccaggaattccacaccaccactaagctggccttctacagcagcacaggctgg
tacaaccgtctgtacattaacttcacgttgcgtcgccacatcttctttttcttgctccaa
acttattttccggctaccctgatggtgatgctgtcctgggtgtccttctggatcgaccgc
agagctgtgcctgccagagtccccttaggaatcaccacggtgctgaccatgtccaccatc
atcacgggcgtgaacgcctccatgccgcgcgtctcctacgtcaaggccgtggacgtctac
ctctgggtgagcttcgtgttcgtgttcctgtcggtgctggagtacgcggccgtcaactac
ctgaccacgggccaggagcggcaggagcggcggctgcgggagcagcttccctgcacctgc
gggtcacctcagccccgcgccgtcctgctggacagcagctatggcgacgtggaggtgacc
gacctgggcaactacgtgccagacaccggcgagaagccagacagggtgatggtgcagctc
gccctggcctcggagaggagctccccgcagaggaaaagtcggaggaacagctacatgagc
atgaggatcgacacccacgccattgacaaatactccaggatcatttttccagcagcctac
attttattcaatttaatatactggtcgattttctcctag

KEGG   Miniopterus natalensis: 107533431
Entry
107533431         CDS       T05883                                 

Gene name
GABRR2
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit rho-2
  KO
K05190  gamma-aminobutyric acid receptor subunit rho
Organism
mna  Miniopterus natalensis
Pathway
mna04080  Neuroactive ligand-receptor interaction
mna04723  Retrograde endocannabinoid signaling
mna04727  GABAergic synapse
mna05032  Morphine addiction
mna05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107533431 (GABRR2)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107533431 (GABRR2)
   04723 Retrograde endocannabinoid signaling
    107533431 (GABRR2)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107533431 (GABRR2)
   05033 Nicotine addiction
    107533431 (GABRR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107533431 (GABRR2)
Ion channels [BR:mna04040]
 Ligand-gated channels
  GABA-A
   107533431 (GABRR2)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 107533431
NCBI-ProteinID: XP_016063601
LinkDB
Position
Unknown
AA seq 465 aa
MPYFTKLILFLFCLMVLVDSRKPKRRRGTGQLEMRKPSHLYKKNPDVTKIRKGKPQQLLR
VEDHDFTMRPAFGGPAIPVGVDVQVESLDSISEVDMDFTMTLYLRHYWKDERLSFSSTSN
KSMTFDGRLVKKIWVPDVFFVHSKRSFIHDTTTDNIMLRVFPDGHVLYSMRITVTAMCNM
DFSHFPLDSQTCSLELESYAYTDEDLMLYWKNGDESLKTDEKISLSQFLIQKFHTTSRLA
FYSSTGWYNRLYINFTLRRHIFFFLLQTYFPATLMVMLSWVSFWIDRRAVPARVSLGITT
VLTMSTIITGVNASMPRVSYVKAVDVYLWVSFVFVFLSVLEYAAVNYLTTVQERQERKLR
EKFPCMCGMLPSRTMMLDGSYSESEANSLAGYPRSHILTEEERQDKIVVHLALSNESNSS
RKKGLLKGQVGLRIFQNTHAIDKYSRLIFPASYIFFNLVYWSVFS
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgccttattttacaaaactcattttgttcttgttttgcctgatggttcttgtggacagc
agaaagcccaagaggaggagagggacagggcagctggaaatgcgcaagccaagccacctt
tataagaagaatccggatgtgaccaaaatccggaaaggaaaacctcagcagctgctcaga
gtggaggaccacgatttcaccatgaggcctgcctttggaggccctgccatcccggtgggt
gtagatgtgcaggtggagagcctggacagcatctcggaggtggacatggacttcactatg
accctgtatctgcggcattactggaaggacgagaggctgtccttcagcagcaccagcaac
aagagcatgacctttgatggccggctggtaaagaagatctgggtccccgatgtcttcttt
gttcactccaaaaggtcattcatccatgacaccaccaccgataacatcatgctgcgggtg
ttcccggatgggcacgtgctgtacagcatgaggattacggtcactgccatgtgcaacatg
gacttcagccactttcccctggactcccagacctgttctttggagctggaaagctatgca
tatacagatgaagatctgatgctgtattggaagaatggggacgaatccctgaaaacagac
gagaagatctccctgtctcagtttctaattcagaaatttcacaccacttccagactggcc
ttctatagcagcactggctggtacaaccgtctgtacattaacttcacgctgcgtcgccac
atcttcttcttcctgctccaaacctatttccctgccaccctgatggtcatgctgtcctgg
gtgtccttctggatcgaccgcagagctgtgcctgccagagtgtcactgggaatcaccacg
gtgctgaccatgtccaccatcatcacgggcgtgaacgcctccatgccgcgcgtctcctac
gtcaaggccgtggacgtctacctctgggtgagcttcgtgttcgtgttcctgtcggtgctg
gagtacgcggccgtcaactacctgaccacggtgcaggagcggcaggagcggaagctgcgg
gagaagttcccgtgtatgtgtggaatgcttccctcaagaaccatgatgctggatggaagc
tacagtgagtctgaggccaacagcttggctggatacccgagaagccatattctgacagaa
gaagagagacaagacaaaatagtggtccacctggccctgagcaatgaatccaattcctcc
aggaagaaggggcttctgaagggccaggtgggtcttcgcatcttccagaacacccacgcc
attgacaaatactccaggttgatattccctgcctcctacatatttttcaacctagtttat
tggtcagtgttttcctag

DBGET integrated database retrieval system