KEGG   Miniopterus natalensis: 107527145
Entry
107527145         CDS       T05883                                 

Gene name
MAP3K1
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 1
  KO
K04416  mitogen-activated protein kinase kinase kinase 1 [EC:2.7.11.25]
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04120  Ubiquitin mediated proteolysis
mna04530  Tight junction
mna04622  RIG-I-like receptor signaling pathway
mna04722  Neurotrophin signaling pathway
mna04912  GnRH signaling pathway
mna04935  Growth hormone synthesis, secretion and action
mna05161  Hepatitis B
mna05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107527145 (MAP3K1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107527145 (MAP3K1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107527145 (MAP3K1)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    107527145 (MAP3K1)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107527145 (MAP3K1)
   04935 Growth hormone synthesis, secretion and action
    107527145 (MAP3K1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107527145 (MAP3K1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107527145 (MAP3K1)
   05161 Hepatitis B
    107527145 (MAP3K1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107527145 (MAP3K1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mna04121]
    107527145 (MAP3K1)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     107527145 (MAP3K1)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: STE group
  STE11 family
   107527145 (MAP3K1)
Ubiquitin system [BR:mna04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    107527145 (MAP3K1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal zf-RING_2 SWIM APH PHD zf-ANAPC11 FANCL_C
Other DBs
NCBI-GeneID: 107527145
NCBI-ProteinID: XP_016055287
LinkDB
Position
Unknown
AA seq 1357 aa
MSSRVPTHIALCVLICEPSVATHCSREMDSRDTLRGLHKMEDRPEERMIREKLKATCMPA
WRHEWLERRSRRGPVVVKPIPVKGDGSEISNLAAEAQGEAQASPASPAPKGRSPSPGSPS
GRTVRPESPGVRRKRASPVPFQSGRTTPPRRAPSPDGFSPYSPEETSRRVNKVMRARLYL
LQQIGPNSFLIGGDSPDNKYRVFIGPQNCSCGRGAFCIHLLFVMLRVFQLEPSDPMLWRK
TLKNFEVESLFQKYHSRRSSRIKAPSRSTIQKFVSRMSNSHTLSSTSASTSSSENSVKDE
EEQMCPICLLGMLDEESLTVCEDGCRNKLHHHCMSIWAEECRRNREPLICPLCRSKWRSH
DFYSHELSSPVDSPTSLRAAQPTPSQRRSQESSFSLTHYGAQQVPPAYRDLAEPWIQVFG
MELVGCLFSRNWNIREMALRRLSHDVSGALLLAHGESTGHSGGAGGGRSSPGAASAPSPP
SAPGDVVGACCSVLSMVCADPVYKVYVAALKTLRAMLVYTPCHSLAERIKLQRLLRPVVD
TILVKCADANSRTSQLSVSTLLELCKGQAGELAVGREILKAGSIGIGGVDYVLNCILGNQ
AESNNWQELLGRLCLIDRLLLEFPAEFYPHIVSTEVPPAEPVEVRYKKLLSLLAFALQSI
DNPHSMVGKLSRRIYLSSARMVTAVPHVFSKLLEMLSVSSSAHFARMRRRLLAIAEEVDI
AEAIQLGLGDTLDSWQDSFLQVSVPKSHPETPEDSPPQCTDHAEKTGRGLRATGLSASSE
DISDRLASISVGLPSSATMERPKPAVQTKGRPHSQCLTSSPVSPHSQLVSPASSTPPVPA
GPGADTSKHRPQGLVPCKAPSASPQTQRKFSLQFQRNCPESKDSDKLSPIFTQARPLPSS
HIHRPKPSRPSPGHTGGQGDTSATGTMLNLSSASEGGDSFGGGSQSGGAVIPSDETVFTP
VDDKCRLDVSTELTSSIEDLLEASMPSSDATVTFQSEVAVLSPEKDQSDDTYKEDVSHNQ
KCKEKMEAEEEEALAIAMALSASQDALPTVPQLQVEKGEDVVIIQQDTPETLPGHTKAKL
PYREDTDWLKGQQIGLGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEI
RMMSHLNHPNIIRMLGATCEKSNYNLFIEWMAGGSVAHLLSKYGAFKESVVINYTEQLLR
GLSYLHENQIIHRDVKGANLLIDSTGQRLRIADFGAAARLASKGTGAGEFQGQLLGTIAF
MAPEVLRGQQYGRSCDVWSVGCAIIEMACAKPPWNAEKHSNHLALIFKIASATTAPSIPS
HLSPGLRDVALRCLELQPQDRPPSRELLKHPVFRTTW
NT seq 4074 nt   +upstreamnt  +downstreamnt
atgtcgtcgcgtgtgccgacccatattgccttatgtgttctcatctgtgaaccgtctgtc
gccacccattgcagccgggagatggacagcagggacaccctccgggggctacacaagatg
gaggaccggccggaggagcggatgatccgggagaagctgaaggccacctgcatgccagcc
tggaggcacgagtggctggagcggaggagccgcaggggccccgtggtggtaaagccaatc
cctgttaaaggagacggatctgaaatcagtaacttggcagctgaggcgcaaggagaggcc
caggcgagcccggcgtctccagctcccaaaggccgcagtccatcccctggctccccgtct
gggcgcacggtgaggcctgagtctccgggagtgaggaggaagagagcgtccccggtgcct
tttcagagtggaaggaccacgccccctcggagagccccgtcccccgacggcttctccccg
tacagccccgaggagactagtcgccgggtgaacaaggtgatgcgggcccggctgtacctg
ctgcagcagatcggccccaactccttcctgatcggaggggacagcccggacaacaagtac
cgcgtgttcatcgggccacagaactgcagctgtgggcgcggggcgttttgcatccacctg
ctgttcgttatgctgcgggtgttccagctggagccttcagacccaatgctgtggagaaag
actttgaagaactttgaggttgagagtttgttccagaaatatcacagtcgccgtagctct
cggatcaaggctccatctcgtagcaccatccagaaattcgtctcccgcatgtccaactct
catacgttgtcatcaactagtgcttccacgtctagctcagaaaacagcgtcaaggatgaa
gaagagcagatgtgccccatctgcctgctgggcatgctggatgaggagagcctgactgtg
tgcgaggatggctgcaggaacaagctgcaccaccactgcatgtccatctgggcagaagaa
tgtagaagaaacagagaacctctgatatgtcccctctgcaggtccaagtggaggtcccat
gacttctacagtcacgagctgtccagccctgtggactctcccacctccctgcgggcggcc
cagccgaccccatcacaacgcaggagccaggagagcagcttcagcctcactcactatgga
gctcagcaggtgcctcctgcctacagagacctggctgagccctggattcaggtgttcggg
atggagctcgtcggctgcttgttttccagaaactggaacatccgggagatggctctccgg
cgtctctcccatgatgtcagcggggcgctgctgctggcccacggggagagcaccggacac
tcggggggcgcgggcgggggccggagcagcccgggggccgccagtgcaccctccccgccc
agtgcgcccggggacgtggtgggcgcctgctgcagcgtgctgtctatggtctgtgccgac
cctgtctacaaagtgtacgttgctgctttaaaaacgctgcgggccatgctggtgtacact
ccctgccacagcctggcggaaagaatcaaactgcagaggctcctccggccggtggtggac
accatcctggtcaagtgtgcagatgccaacagccgcacaagccagctgtctgtgtcgacc
ctgttggagctgtgcaagggccaggcgggggagctggcagttggcagagaaatccttaaa
gctggatccattggtattggtggtgttgattacgtcttaaattgcattcttggaaaccaa
gcagaatctaacaactggcaggagctcctgggccgcctctgtctcatcgacaggctgctg
ctggagtttcctgctgagttttacccccacattgtcagcaccgaggttccaccagccgag
cctgtggaagtcaggtataagaagctgctgtccctcctggcctttgcgttgcagtccatt
gataatccccactcgatggtcggcaagctctcccggaggatctatctgagctctgcgcgg
atggtcaccgccgttccccacgtgttttcaaagctgttagaaatgctcagtgtctccagc
tctgcccactttgccaggatgcgacgccgtttgctggccatcgcagaggaggtggacatc
gccgaggccatccagctgggcctaggggacaccctggacagctggcaggacagctttctg
caggtttctgtccctaagagccatccagaaaccccagaggacagcccccctcagtgcaca
gaccatgcagagaaaactggaagagggctgcgggccacggggctgagtgccagctccgag
gacatttccgacaggctggccagcatctccgtcggacttcctagctcagcgacgatggag
cggccaaagccagcggttcagacgaaaggcaggccccacagtcagtgtttgacctcctct
cccgtgtcccctcactcccagctggtgtccccggcctcctccaccccgcctgtccccgct
ggccctggagcagacacctccaagcacagacctcagggcctcgttccctgcaaagcaccc
tctgcttcgccccagactcagcgcaagttttccctgcagttccagagaaactgtcccgaa
agcaaagactcagacaagctctccccaatcttcacccaggccaggcccctgccctccagt
catatacacaggccaaagccatcccgcccctccccaggccacacgggtggacagggagac
acctctgcaactggcacgatgctcaacctgagcagtgcatccgaaggtggcgacagcttt
ggtggcggcagccaaagtggcggcgctgtgatccctagcgacgagacggtgttcaccccc
gtggacgacaagtgcaggctggatgtcagcaccgagctcacctccagcattgaggacctt
ctggaggcctccatgccctcaagcgatgccaccgtgacgtttcagtcggaagttgctgtc
ctctctcctgagaaggatcaaagtgatgacacctacaaagaggacgtgagtcacaatcag
aagtgcaaggaaaagatggaggcggaggaggaggaggcgttagccatcgccatggcgctg
tccgcatctcaggacgccctccccacggtgccccagctgcaggtggagaagggagaggac
gtcgtcatcatccagcaggacacaccggagactctgccaggacacaccaaagcgaaactg
ccctacagagaggacacggactggctgaaggggcagcagatcggcctcggggctttctct
tcctgttaccaggctcaggacgtgggaactgggaccttaatggctgttaaacaggtgacg
tacgtcagaaacacgtcgtcggagcaggaggaggtggtggaggcgctgagggaggagatc
aggatgatgagccacctgaaccaccccaacatcatcaggatgctgggggccacctgtgag
aagagcaattacaacctcttcatcgagtggatggcagggggatctgtggcacatttgctc
agtaaatacggagccttcaaggagtccgtggttatcaactacactgagcaattactccgc
ggcctctcgtatctccatgaaaaccagatcatccacagggatgtcaaaggtgccaacctg
ctcattgacagcacaggtcagaggctgagaattgctgattttggagctgccgccaggttg
gcatcaaaaggaactggtgctggagagtttcagggacagttactggggaccattgcgttc
atggcacccgaggtcctgagaggccagcagtatgggaggagctgcgacgtgtggagcgtg
ggctgtgccatcatagagatggcctgtgctaagccgccctggaatgcagagaagcactcc
aatcatctcgctctgatatttaagatcgcaagtgcaacaactgctccatcgatcccttcc
cacctgtctcccgggttacgggacgtggctcttcgctgtttagaacttcaacctcaggac
agacctccgtcgagagagctactgaagcatcccgtcttccgcacgacgtggtag

DBGET integrated database retrieval system