KEGG   Miniopterus natalensis: 107527162
Entry
107527162         CDS       T05883                                 

Gene name
GPX8
Definition
(RefSeq) probable glutathione peroxidase 8 isoform X1
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mna  Miniopterus natalensis
Pathway
mna00480  Glutathione metabolism
mna00590  Arachidonic acid metabolism
mna01100  Metabolic pathways
mna04918  Thyroid hormone synthesis
mna05014  Amyotrophic lateral sclerosis
mna05016  Huntington disease
mna05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    107527162 (GPX8)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107527162 (GPX8)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    107527162 (GPX8)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107527162 (GPX8)
   05016 Huntington disease
    107527162 (GPX8)
   05022 Pathways of neurodegeneration - multiple diseases
    107527162 (GPX8)
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     107527162 (GPX8)
SSDB
Motif
Pfam: GSHPx AhpC-TSA
Other DBs
NCBI-GeneID: 107527162
NCBI-ProteinID: XP_016055310
LinkDB
Position
Unknown
AA seq 210 aa
MEPLAAQPLRCSGPRARLFAVLLSMALCTGTLFLLQLKFLKPKVSSFYTFEVKDAKGRPV
SLEKFRGKEVTLVANVASDCQLTDSNYLALQELHREFGPFHFSVLAFPCNQFGESEPRPS
REVVSFARNSYGATFPIFHKIKVLGPEAEPAFRFLVDSSKKEPRWNFWKYLVNPEGQVVK
TWRPEEPIEVIRPEIADLIRQMIIKKREDL
NT seq 633 nt   +upstreamnt  +downstreamnt
atggagcccctggcggctcagcctctgagatgctcggggccccgggcgaggctgttcgcg
gtcctgctgtcgatggcgctgtgcacggggaccctgttcctcctgcagctgaagttcctg
aagcccaaagtcagcagcttctacacctttgaagtgaaagatgccaaaggcaggcccgtt
tctctggaaaagtttagaggcaaagaggtcaccctagttgccaacgtggccagtgactgc
cagctcacggacagcaactacttagcgctgcaggagctgcaccgggagttcgggcccttc
cacttcagcgtcctggcctttccctgcaaccagttcggggagtcggagccccgccccagc
agggaggtggtctccttcgcgagaaacagctacggagccacgttccccatcttccacaag
atcaaggtcctgggccctgaagcagagcctgcgttcagatttcttgttgattcttcaaag
aaagaaccaagatggaatttttggaaatatctggtcaaccccgagggtcaagttgtgaag
acctggaggccagaggagcccattgaagtcatccggcctgagatcgcagatctgattaga
caaatgatcattaagaaaagagaggatctatga

KEGG   Miniopterus natalensis: 107529364
Entry
107529364         CDS       T05883                                 

Gene name
GPX1
Definition
(RefSeq) glutathione peroxidase 1
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mna  Miniopterus natalensis
Pathway
mna00480  Glutathione metabolism
mna00590  Arachidonic acid metabolism
mna01100  Metabolic pathways
mna04918  Thyroid hormone synthesis
mna05014  Amyotrophic lateral sclerosis
mna05016  Huntington disease
mna05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    107529364 (GPX1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107529364 (GPX1)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    107529364 (GPX1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107529364 (GPX1)
   05016 Huntington disease
    107529364 (GPX1)
   05022 Pathways of neurodegeneration - multiple diseases
    107529364 (GPX1)
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     107529364 (GPX1)
SSDB
Motif
Pfam: GSHPx Redoxin
Other DBs
NCBI-GeneID: 107529364
NCBI-ProteinID: XP_016058214
LinkDB
Position
Unknown
AA seq 180 aa
LAGGEPVSLGSLQGKVLLIENVASLUGTTVRDYTQMNELQKRLGPRGLVVLGFPCNQFGH
QENAKNEEILNSLKYVRPGGGFEPNFTLFEKCEVNGAQAHPLFVFLREALPAPSDDATAL
MTDPKFIIWSPVCRNDISWNFEKFLVGPDGVPVRRYSRRFPTIDIEPDIEALLTKGPGSA
NT seq 543 nt   +upstreamnt  +downstreamnt
ctggccggcggggagcccgtgagcctgggctccctgcagggcaaggtgctgctcattgag
aatgtggcctcgctctgaggcacaacggtccgggactacacccagatgaacgagctgcag
aagcgccttgggccccggggcctggtcgtgcttggcttcccgtgcaaccagttcgggcat
caggagaacgccaagaacgaagagatcctgaattccctcaagtatgtcaggcctgggggc
gggttcgagcccaacttcacgctcttcgagaagtgcgaggtgaacggcgcgcaggcgcac
ccactcttcgtcttcctgcgggaggctctgcccgcacccagtgacgacgccactgcgctc
atgaccgaccccaagttcatcatctggtctccggtgtgccgcaacgacatctcctggaac
ttcgagaagttcctggtgggcccggacggggtgcctgtgcgcaggtacagccgccgcttt
ccgaccattgacatcgagccagacatcgaagccctgctgaccaaggggccgggcagtgcc
tag

KEGG   Miniopterus natalensis: 107535405
Entry
107535405         CDS       T05883                                 

Gene name
GPX7
Definition
(RefSeq) glutathione peroxidase 7
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mna  Miniopterus natalensis
Pathway
mna00480  Glutathione metabolism
mna00590  Arachidonic acid metabolism
mna01100  Metabolic pathways
mna04918  Thyroid hormone synthesis
mna05014  Amyotrophic lateral sclerosis
mna05016  Huntington disease
mna05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    107535405 (GPX7)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107535405 (GPX7)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    107535405 (GPX7)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107535405 (GPX7)
   05016 Huntington disease
    107535405 (GPX7)
   05022 Pathways of neurodegeneration - multiple diseases
    107535405 (GPX7)
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     107535405 (GPX7)
SSDB
Motif
Pfam: GSHPx
Other DBs
NCBI-GeneID: 107535405
NCBI-ProteinID: XP_016066336
LinkDB
Position
Unknown
AA seq 279 aa
MPLLSLCQERVGKNNPSILRSLSRPSPVSESAAGGADDTESYENILEMNVQCRGMHGCLT
QIVLQGGHEGPEREDIFGQGHTALESTEPGGEPFIHPWSTLGRLLRWQLRVKYESSRLLP
PYQEASQLRVDFREKVCGVSLVVNVASECGFTEEHYRALQQLQRDLGPHHFNVLAFPCNQ
FGQQEPDSNKEIESFARRTYSVSFPMFSKVAVTGTGAHPAFKYLTQTSGKEPTWNFWKYL
VAPDGKVVGAWDPTVSVEEIRPQITALVRKLILKKREDL
NT seq 840 nt   +upstreamnt  +downstreamnt
atgcctctgctcagcctttgtcaggaaagggtgggaaaaaataaccctagcatcctgcgg
tctttgtctcgcccatccccagtttccgagtctgcagctgggggagcggatgatactgag
tcctacgagaacattctggaaatgaatgtgcagtgcagaggaatgcacgggtgccttaca
cagatcgtcctccagggaggacacgaaggcccagagagggaagatatatttggacagggt
cacacagcgctagaaagcacggagcctggaggagaaccattcatccacccttggtctact
ctaggcagactcctaagatggcagctcagggtgaaatatgagtcatccaggctgctacct
ccttaccaagaggcatctcagctcagagtggacttcagagagaaagtgtgtggggtgtcc
ctggtggtgaatgtggccagcgagtgtggcttcacagaggaacactaccgggccctgcag
cagctacagcgagacctggggccccaccacttcaatgtgcttgccttcccctgcaaccag
tttggccaacaggagcccgacagcaacaaggaaattgagagttttgcccgccgcacctac
agtgtctctttccccatgtttagcaaggtcgcagtgactggaactggtgcccaccctgcc
ttcaagtacctgacccaaacttctggaaaggagcccacttggaacttctggaagtaccta
gtggccccggatggaaaggtggtaggggcttgggacccaaccgtgtcggtggaggagatc
agaccccagatcacagcgcttgtgaggaagctcatcctgaagaagcgagaagacttataa

KEGG   Miniopterus natalensis: 107537976
Entry
107537976         CDS       T05883                                 

Gene name
GPX3
Definition
(RefSeq) glutathione peroxidase 3
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mna  Miniopterus natalensis
Pathway
mna00480  Glutathione metabolism
mna00590  Arachidonic acid metabolism
mna01100  Metabolic pathways
mna04918  Thyroid hormone synthesis
mna05014  Amyotrophic lateral sclerosis
mna05016  Huntington disease
mna05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    107537976 (GPX3)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107537976 (GPX3)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    107537976 (GPX3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107537976 (GPX3)
   05016 Huntington disease
    107537976 (GPX3)
   05022 Pathways of neurodegeneration - multiple diseases
    107537976 (GPX3)
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     107537976 (GPX3)
SSDB
Motif
Pfam: GSHPx
Other DBs
NCBI-GeneID: 107537976
NCBI-ProteinID: XP_016069585
LinkDB
Position
Unknown
AA seq 222 aa
MPPPASVSSPSGPALTAAGAGLLLQTDCHSQVSGTIYDYGALTLNGEEYIPFKQYAGKYV
LFVNVASYUGLTGQYVELNALQEELEPFGLVILGFPCNQFGKQEPGQNSEILPSLKYVRP
GGGFVPNFQLFEKGDVNGENEQKVYTFLKNSCPPTSELLGSPNRLFWEPMKVHDIRWNFE
KFLVGPDGKPIMRWYHRTTVSNVKVDILAYMRQQEALAAARK
NT seq 669 nt   +upstreamnt  +downstreamnt
atgccaccgccggcatcagtgtcgtctccttcagggcctgctctaaccgccgccggcgct
ggtcttctgttgcagacggactgccattcccaagtgagtggcaccatctacgactatgga
gccctcaccctcaacggggaggagtacatccccttcaagcagtatgctggcaaatacgtc
ctctttgtcaacgtggccagctactgaggcctgacgggccagtacgttgaactgaatgca
ctacaggaagagctggaaccatttggtctggtcattctgggcttcccctgcaaccaattc
ggaaaacaggagccaggacagaactcggagatcctaccttccctcaagtatgtacgaccg
ggggggggcttcgtccccaatttccagctctttgagaaaggagatgtgaatggggagaat
gaacaaaaggtctacacgttcctgaagaactcctgtcctcccacctcggagctcctgggc
tcgcctaaccgcctcttctgggaacctatgaaggtccatgacatccgctggaactttgag
aagttcctggtggggccagatggcaaacccatcatgcgctggtaccaccggaccacagtc
agcaacgtcaaggtggacatcctggcctacatgaggcagcaggaagccctggcggccgcc
aggaagtaa

KEGG   Miniopterus natalensis: 107543157
Entry
107543157         CDS       T05883                                 

Definition
(RefSeq) epididymal secretory glutathione peroxidase-like
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mna  Miniopterus natalensis
Pathway
mna00480  Glutathione metabolism
mna00590  Arachidonic acid metabolism
mna01100  Metabolic pathways
mna04918  Thyroid hormone synthesis
mna05014  Amyotrophic lateral sclerosis
mna05016  Huntington disease
mna05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    107543157
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107543157
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    107543157
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107543157
   05016 Huntington disease
    107543157
   05022 Pathways of neurodegeneration - multiple diseases
    107543157
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     107543157
SSDB
Motif
Pfam: GSHPx
Other DBs
NCBI-GeneID: 107543157
NCBI-ProteinID: XP_016076100
LinkDB
Position
Unknown
AA seq 221 aa
MAAQLRASCLIPLLLAGFVQTHPKLEKMKMDCYKDVKGTIYEYDALSLDGKERISFKQYA
GKHVLFVNVATYCGLTVQYPELNTLQEELKPFGLVVLGFPCNQFGKQEPGENSEILPGLK
YVRPGGGYVPSFQLFEKGDVNGEKEQKVFTFLKQSCPHPSELLGSFKHISWEPIKVQDIR
WNFEKFLVGPDGVPVMRWFHRAPVSDVKSDIRTYLKQFKIE
NT seq 666 nt   +upstreamnt  +downstreamnt
atggctgcacagctgcgggcatcctgtctcatccccctcctcctagctggctttgtgcag
acgcaccccaagctggagaagatgaagatggattgctacaaagatgtaaaaggcaccatc
tatgaatatgatgccctcagtcttgatggaaaggaacgcatttcgttcaagcagtatgcg
ggaaagcatgtcctttttgtcaatgtggccacctactgtggtctaacagttcaatatcct
gaactgaacacacttcaggaggagctgaagccctttggcttggttgtattgggctttccc
tgcaatcaatttggaaagcaagaaccaggagagaactcagagatccttcccggactaaag
tatgtccgtccagggggaggatatgtacccagtttccagctctttgagaaaggcgatgtg
aatggcgaaaaagagcagaaggtcttcacctttctgaagcaatcctgtcctcacccttct
gagcttttgggctctttcaaacatatctcctgggagcccataaaggtccaggacattcgc
tggaattttgaaaagttcctggtggggcctgatggagtccctgtcatgcgctggttccat
cgggctccagtcagtgacgtcaagtcagatatccggacgtacctgaagcagttcaagatc
gagtag

KEGG   Miniopterus natalensis: 107545682
Entry
107545682         CDS       T05883                                 

Gene name
GPX2
Definition
(RefSeq) glutathione peroxidase 2
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mna  Miniopterus natalensis
Pathway
mna00480  Glutathione metabolism
mna00590  Arachidonic acid metabolism
mna01100  Metabolic pathways
mna04918  Thyroid hormone synthesis
mna05014  Amyotrophic lateral sclerosis
mna05016  Huntington disease
mna05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    107545682 (GPX2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107545682 (GPX2)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    107545682 (GPX2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107545682 (GPX2)
   05016 Huntington disease
    107545682 (GPX2)
   05022 Pathways of neurodegeneration - multiple diseases
    107545682 (GPX2)
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     107545682 (GPX2)
SSDB
Motif
Pfam: GSHPx
Other DBs
NCBI-GeneID: 107545682
NCBI-ProteinID: XP_016079307
LinkDB
Position
Unknown
AA seq 190 aa
MAFIAKSFYDLSAVSLDGEKIDFNTFRGRAVLIENVASLUGTTTRDFTQLNELQCRFPRR
LVVLGFPSNQFGHQENCQNEEILNSLKYVRPGGGFQPTFTLTQKCEVNGQNEHPVFAYLK
DKLPYPYDDPFSLMTDPKLIIWSPVRRSDVSWNFEKFLIGPEGEPFRRYSRTFPTANIEP
DIKRLLKVAI
NT seq 573 nt   +upstreamnt  +downstreamnt
atggcgttcattgccaagtccttctatgacctttctgctgtgagcctggatggggagaag
atagatttcaatacattccgaggccgggcggtgctgattgagaacgtagcatcgctctga
ggcacaaccacccgggacttcacccagctcaacgagctgcaatgccgctttcccaggcgc
ctggtggtcctcggcttcccttccaaccaatttggacatcaggagaactgtcagaatgag
gagatcctgaacagtctcaagtatgtccgccctgggggtgggttccagcccacctttacc
cttacccagaagtgtgaggtgaatggtcagaacgagcatcctgtcttcgcctacctgaag
gacaagctcccctacccttacgacgacccgttttctctcatgaccgaccccaagctcatc
atctggagcccagtgcgccgctcagacgtgtcctggaactttgagaagttcctgatcggg
ccggagggggagcccttccgacgctacagccgcaccttccccaccgccaacatcgagccg
gacatcaagcgcctcctcaaagttgccatatag

DBGET integrated database retrieval system