KEGG   Miniopterus natalensis: 107527170
Entry
107527170         CDS       T05883                                 

Gene name
CACNA2D1
Definition
(RefSeq) voltage-dependent calcium channel subunit alpha-2/delta-1
  KO
K04858  voltage-dependent calcium channel alpha-2/delta-1
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna04921  Oxytocin signaling pathway
mna05410  Hypertrophic cardiomyopathy
mna05412  Arrhythmogenic right ventricular cardiomyopathy
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107527170 (CACNA2D1)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107527170 (CACNA2D1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107527170 (CACNA2D1)
   04261 Adrenergic signaling in cardiomyocytes
    107527170 (CACNA2D1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107527170 (CACNA2D1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107527170 (CACNA2D1)
   05414 Dilated cardiomyopathy
    107527170 (CACNA2D1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107527170 (CACNA2D1)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107527170 (CACNA2D1)
SSDB
Motif
Pfam: VGCC_alpha2 VWA_N VWA VWA_3 VWA_2 dCache_1 IFN-gamma
Other DBs
NCBI-GeneID: 107527170
NCBI-ProteinID: XP_016055320
LinkDB
Position
Unknown
AA seq 1072 aa
MRARREKKDLKNIFFSNYCSIKSWVDKMQEDLVTLAKTASGVNQLVDIYEKYQDLYTVEP
NNARQLVEIAARDIEKLLSNRSKALVRLALEAEKVQAAHQWREDFASNEVVYYNAKDDLD
PEKNDSEPGSQRIKPVFIDDANFGRQISYQHAAVHIPTDIYEGSTIVLNELNWTSALDEV
FKKNRDEDPSLLWQVFGSATGLARYYPASPWVDNSRTPNKIDLYDVRRRPWYIQGAASPK
DMLILVDVSGSVSGLTLKLIRTSVSEMLETLSDDDFVNVASFNSNAQDVSCFQHLVQANV
RNKKVLKDAVNNITAKGITDYKKGFSFAFEQLLNYNVSRANCNKIIMLFTDGGEERAQEI
FAKYNKDRKVRVFTFSVGQHNYDRGPIQWMACENKGYYYEIPSIGAIRINTQEYLDVLGR
PMVLAGDKAKQVQWTNVYLDALELGLVITGTLPVFNITGQVENKTNLKNQLILGVMGVDV
SLEDIKRLTPRFTLCPNGYYFAIDPNGYVLLHPNLQPKNPKSQEPVTLDFLDAELENDIK
VEIRNKMIDGESGEKTFRTLVKSQDERYIDKGNRTYTWTPVNGTDYSLALVLPTYSFYYI
KAKIEETITQARYSETLKPDNFEESGYTYLAPRDYCNDLKISENNTEFLLNFNEFIDRKT
PNNPSCNKDLINRVLLDAGFTSELVQNYWSKQKNIKGVKARFVVTDGGITRVYPKEAGEN
WQENPETYEDSFYKRSLDNDNYVFTAPYFNKSGPGAYESGIMVSKAVEIYIQGKLLKPAV
VGIKIDVNSWIENFTKTSIRDPCAGPVCDCKRNSDVMDCVILDDGGFLLMANHDDYTNQI
GRFFGEIDPSLMRHLINISVYAFNKSYDYQSVCEPGAAPKQGAGHRSAYVPSIADILHIG
WWATAAAWSILQQLILSLTFPRLLEAVDMEDDDFTASISKQSCITEQTQYFFDNDSKSFS
GVLDCGNCSRIFHVEKLMNTNLVFIMVESKGTCPCDTRLLIQAEQTSDGPDPCDMVKQPR
YRKGPDVCFDNNDLEDYTDCGGASGLNPSLWSIIGIQFVLLWLLSGIRHCQL
NT seq 3219 nt   +upstreamnt  +downstreamnt
atgagagctaggagagagaagaaagatttaaagaatattttcttctctaattactgcagc
atcaagtcatgggtggataagatgcaagaagaccttgtcacactggcgaagacagcaagt
ggagtcaatcagcttgtcgatatttatgaaaaataccaagatttgtatactgtggaacca
aataatgcacgccagctggtggaaattgcagccagggatattgaaaaacttctaagcaac
agatctaaagccctggtgcgcctggctttggaagcggagaaagttcaagcagcccaccag
tggagggaagattttgcaagtaatgaagttgtctactacaatgcaaaggacgatctcgat
cctgaaaaaaatgacagtgagcccggcagccagaggataaagcctgtttttatagatgat
gctaattttggaagacaaatatcctatcagcacgcagcagtccatattcccaccgacatc
tatgagggctcaacaattgtgttaaatgaactcaactggacaagtgccttagatgaagtt
ttcaaaaaaaatcgagatgaagatccttcattgttgtggcaggtgtttggcagtgccaca
ggcctggcccgatactatccagcttctccatgggttgataacagccgaactccaaacaag
attgacctttatgatgtacgcagaagaccatggtacatccaaggagctgcatctcctaaa
gatatgcttattctggttgatgtgagtggaagcgttagtggattgacacttaaattgatc
cgaacgtctgtctccgaaatgttggaaaccctctcagatgatgattttgtgaatgtagct
tcatttaacagcaatgcccaggatgtaagctgttttcagcaccttgtacaagcaaatgta
agaaacaagaaagtactgaaagatgccgtgaataatatcacagcaaaaggaattacagat
tataagaagggctttagctttgcttttgaacagctgcttaattataatgtttccagagct
aactgcaataagattatcatgctgttcacggacggaggagaagagagagcccaggagata
tttgccaaatacaacaaagacagaaaagtacgtgtattcacattttcagttggtcaacat
aattatgacagaggacctattcagtggatggcctgtgaaaataaaggttattattatgaa
attccttccattggagcaataagaatcaatactcaggaatatttggatgttctgggaaga
ccaatggttttagcaggagacaaagctaagcaagtccagtggacaaatgtgtacctggat
gcactggaactgggacttgtcattactggaactcttccggtcttcaatataaccggccaa
gttgaaaataagacaaacttaaagaaccagctgattcttggtgtgatgggagttgatgtc
tctttggaagatattaaaagactaacaccacgttttacactatgccccaatggctattat
tttgcaattgaccctaatggttatgttttattacacccaaatcttcagccaaagaacccc
aaatcacaggaaccagtaactctggatttccttgatgcagaattagagaatgacattaaa
gtggagattcgcaataaaatgatagatggagaaagtggagaaaaaacattcagaactctg
gttaaatctcaagatgagaggtatattgacaaaggaaacaggacatatacatggactcct
gtcaatggaacagattacagtttggccttggtattaccaacctacagtttttactatata
aaagccaaaatagaagagacaataactcaggccagatattcagagacactgaagccggat
aattttgaagaatctggttatacatacttagcaccaagagattactgcaatgaccttaaa
atatcagagaataacactgaatttcttttaaatttcaatgagtttattgatagaaaaact
ccaaacaatccatcctgtaacaaggatttgattaatcgggtcttgctggatgcaggtttt
acaagtgaactggtccaaaattattggagtaagcagaaaaacataaagggagtgaaagca
cggtttgttgtgactgatggtgggattaccagagtttatcccaaagaggctggagaaaat
tggcaagaaaacccagaaacgtatgaggacagcttctataaaaggagtcttgataatgat
aactatgttttcactgctccctactttaacaaaagcggacctggtgcttatgaatcaggt
attatggtaagcaaagctgtagaaatatatatccaaggaaaacttcttaaacctgcagtt
gttggaattaaaattgatgtaaattcctggatagagaatttcaccaaaacatcaatcagg
gatccgtgtgctggtccagtttgtgactgcaaaagaaacagtgatgtaatggattgtgtg
attctagatgatggtgggtttcttttaatggcaaatcatgatgattatactaaccagatt
ggaagattttttggagagattgatcctagtttgatgagacacctgattaatatatcggtc
tatgcttttaacaaatcctacgattaccagtcagtgtgtgagcctggtgcggcaccaaag
caaggcgcagggcatcgctcggcatacgtgccatcaatagcggacatattgcacatcggc
tggtgggctactgctgctgcgtggtctattctacagcagttaatcttgagtttgaccttt
ccacgacttcttgaggcagttgacatggaagatgatgactttacagcctctatatcaaag
cagagctgcattactgaacaaacacagtatttctttgataatgatagtaaatcattcagt
ggagtattagactgtggaaactgttccagaatctttcatgtagaaaaacttatgaacacc
aacttagtattcataatggttgagagcaaagggacttgtccctgtgacacacggctgctc
atacaagcagagcagacttctgatggtccagatccttgtgatatggttaagcaacccaga
taccgaaaagggcctgacgtctgctttgataacaatgacttggaggattataccgactgt
ggcggcgcttcgggcttaaacccctccctgtggtccatcattggcatccagtttgtactt
ctctggcttttatctggcatcagacactgccagttatga

KEGG   Miniopterus natalensis: 107528234
Entry
107528234         CDS       T05883                                 

Gene name
CACNB3
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit beta-3 isoform X1
  KO
K04864  voltage-dependent calcium channel beta-3
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna04921  Oxytocin signaling pathway
mna05410  Hypertrophic cardiomyopathy
mna05412  Arrhythmogenic right ventricular cardiomyopathy
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107528234 (CACNB3)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107528234 (CACNB3)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107528234 (CACNB3)
   04261 Adrenergic signaling in cardiomyocytes
    107528234 (CACNB3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107528234 (CACNB3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107528234 (CACNB3)
   05414 Dilated cardiomyopathy
    107528234 (CACNB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107528234 (CACNB3)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107528234 (CACNB3)
SSDB
Motif
Pfam: Guanylate_kin VGCC_beta4Aa_N SH3_1
Other DBs
NCBI-GeneID: 107528234
NCBI-ProteinID: XP_016056702
LinkDB
Position
Unknown
AA seq 488 aa
MYDDSYVPGFEDSEAGSADSYTSRPSLDSDVSLEEDRESARREVESQAQQQLERAKHKPV
AFAVRTNVSYCGVLDEECPVQGSGVNFEAKDFLHIKEKYSNDWWIGRLVKEGGDITFIPS
PQRLESIRLKQEQKARRSGNPSSLSDIGNRRSPPPSLGSLSPAHLSWEAEHVPPYDVVPS
MRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFDGRISITRVTADLSLAKRSVLNNPGKRT
IIERSSARSSIAEVQSEIERIFELAKSLQLVVLDADTINHPAQLAKTSLAPIIVFVKVSS
PKVLQRLIRSRGKSQMKHLTVQMMAYDKLVQCPPESFDVILDENQLEDACEHLAEYLEVY
WRATHHPAPSPGLLGPPSAIPGLQNQQLLGERGEEHSPLERDSLMPSDEASESSRQAWTG
SSQRSSRHLEEDYADAYQDLYQPHRQHTSGLPSANGHDPQDRLLVQDSEHNHNDRNWQRN
RPWPKDSY
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgtatgacgactcctacgtgcccgggtttgaggactcggaggcgggttcagccgactcc
tataccagtcgtccatctctggactcagacgtctccctggaggaggaccgggagagtgcc
cggcgagaagtggagagccaggctcagcagcagctggagagggccaagcacaaacctgtg
gcatttgctgtgaggaccaatgtcagctactgtggtgtactggacgaggagtgcccagtc
cagggctctggagtcaactttgaggccaaagattttctgcacattaaagagaagtacagc
aatgattggtggatcgggaggctagtgaaagagggcggagacatcaccttcatccccagc
ccccagcgcctggagagcatccggctcaagcaggagcagaaggccaggagatccgggaac
ccctccagcctgagtgacattggcaaccgacgctcccctcctccatctctaggtagcctc
tctccagcccacctgtcttgggaggcagaacatgttcccccatatgatgtggtgccctcc
atgcggcctgtggtgctggtgggaccctctctgaaaggttatgaggtcacagacatgatg
cagaaggctctctttgacttcctcaaacataggtttgatggcaggatctccatcacccga
gtcacagctgacctctcactggcaaagcgatctgtgctcaacaatcctggcaagaggacc
atcattgagcgttcctctgcccgctccagcattgctgaagtacagagtgagattgagcgc
atttttgagctggccaaatccctgcagctggttgtgttggatgctgacaccatcaaccac
ccagcacagctggccaagacctcactggcccccatcatcgtgtttgtcaaagtgtcctca
ccaaaggtactccagcgtctcatccgctcccgcgggaagtcacagatgaagcacctgact
gtacagatgatggcatatgataagctggttcagtgcccaccagagtcatttgatgtgatt
ttggatgagaaccagctggaggatgcttgtgagcacctggctgagtacctggaggtttac
tggcgggccacccaccacccagcccctagccctggacttctgggtcctcccagtgccatc
cccggacttcagaaccagcagctgctgggggagagaggcgaggagcactcacccctcgag
cgggacagcttgatgccctcagatgaggccagcgagagctcccgccaagcctggacagga
tcttcgcagcgtagctcccgccacctggaagaggactatgcagacgcctaccaggacctg
taccagcctcaccgccagcacacctctgggctgcctagtgctaatgggcatgacccccaa
gaccgactcctcgtccaggactcggagcacaatcacaatgaccggaactggcagcgcaac
cggccctggcccaaggatagctactga

KEGG   Miniopterus natalensis: 107529017
Entry
107529017         CDS       T05883                                 

Gene name
CACNB1
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit beta-1
  KO
K04862  voltage-dependent calcium channel beta-1
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna04921  Oxytocin signaling pathway
mna05410  Hypertrophic cardiomyopathy
mna05412  Arrhythmogenic right ventricular cardiomyopathy
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107529017 (CACNB1)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107529017 (CACNB1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107529017 (CACNB1)
   04261 Adrenergic signaling in cardiomyocytes
    107529017 (CACNB1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107529017 (CACNB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107529017 (CACNB1)
   05414 Dilated cardiomyopathy
    107529017 (CACNB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107529017 (CACNB1)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107529017 (CACNB1)
SSDB
Motif
Pfam: Guanylate_kin VGCC_beta4Aa_N SH3_1 SH3_2 SPATA3
Other DBs
NCBI-GeneID: 107529017
NCBI-ProteinID: XP_016057775
LinkDB
Position
Unknown
AA seq 643 aa
MVQKTSMSRGPYPPSQEIPMEVFDPSPQGKYSKRKGRFKRSDGSTSSDTTSNSFVRQGSA
ESYTSRPSDSDVSLEEDREALRKEAERQALAQLEKAKTKPVAFAVRTNVGYNPSPGDEVP
VQGVAITFEPKDFLHIKEKYNNDWWIGRLVKEGCEVGFIPSPVKLDSLRLLQEQKLRQNR
LSSSKSGDNSSSSLGDVVTGTRRPTPPASGNEMTNLAFELDPLELEDEEAELGEHGGSAK
TSVSSVTTPPPHGKRIPFFKKTEHVPPYDVVPSMRPIILVGPSLKGYEVTDMMQKALFDF
LKHRFDGRISITRVTADISLAKRSVLNNPSKHIIIERSNTRSSLAEVQSEIERIFELART
LQLVALDADTINHPAQLSKTSLAPIIVYIKITSPKVLQRLIKSRGKSQSKHLNVQIAASE
KLAQCPPEMFDIILDENQLEDACEHLAEYLEAYWKATHPPSSTPPNPLLNRTMASAALAA
SPAPVSNLQGPYLASGDQSLERATGEHASVQEYPGELGQPPGLYPSSHPPGRVGTVRALS
RQDTFDADTSGNRNSAYTELGDSCVDMETDPSEGPGLGDPAGGSTPPARQGSWEDEEEDY
EEELTDNRNRGRNKARYCAEGGGPVLGRNKNELEGWGRGVYIR
NT seq 1932 nt   +upstreamnt  +downstreamnt
atggtccagaagaccagcatgtcccggggcccttacccaccctcccaggagattcccatg
gaggtcttcgaccccagcccgcagggcaaatacagcaagaggaaagggcggttcaaaagg
tcggatggaagcacatcctcggatacaacgtccaacagctttgtgcgccagggctcagca
gagtcctacaccagccgtccatcggactctgacgtgtctctggaagaggaccgggaagcc
ttaaggaaggaagcagagcgccaggcattagcccagcttgagaaagccaagaccaagccg
gtggcatttgctgttcggacaaatgtcggctacaacccgtctccaggggatgaggtgcct
gtgcagggagtggccatcaccttcgagcccaaggacttcctgcacatcaaagagaaatac
aataatgactggtggatcgggcgactggtgaaggagggctgtgaggttggcttcatccct
agccctgtcaaactggacagcctgcgtctgctgcaggagcagaaactgcgtcagaaccgc
ctcagctccagcaaatcaggtgacaattccagctccagtctgggagatgtggtgactggc
acccgccgccccacgccccctgccagtggtaacgaaatgactaacttagcctttgaacta
gatcccctagagttagaggacgaggaggcggagcttggggagcatggcggctctgccaag
actagtgttagcagtgtcaccaccccgccaccccatggcaagcgcatccccttcttcaag
aagacagagcatgtacccccctatgacgtggtgccttccatgaggcccatcatcctggtg
ggaccgtcgctcaagggctatgaggttacggacatgatgcagaaagctttgttcgacttc
ttaaagcatcggtttgacggcaggatctccatcactcgtgtgacagcagacatttccctg
gctaagcgctcagtcctcaacaaccccagcaaacacatcatcattgagcgctccaacaca
cgctccagcctggctgaggttcagagcgagattgagcgaatcttcgagctggcccggacc
cttcagttggttgctctggacgccgacaccatcaaccacccggcccagctctccaagacc
tcactggcccccatcattgtttacatcaagatcacctctcccaaggtacttcagaggctc
atcaagtctcgagggaagtctcagtccaaacacctcaatgtgcaaatagcggcctcggag
aagctggcgcagtgtcctcctgaaatgtttgacatcatcctggacgagaaccagttggag
gatgcctgcgagcacttggctgaatacttggaagcctattggaaggccacacacccgccc
agcagcactccacctaacccactgctgaaccgcaccatggctagtgcagccctggctgcc
agccctgcccctgtctccaacctccagggaccctaccttgcttccggggaccagtcgctg
gaacgggccaccggggagcacgccagtgtgcaggagtacccgggggagctgggccaaccc
ccaggcctttaccccagcagccacccaccaggccgggttggcaccgtgcgggcactatcc
cgccaagacacgtttgatgccgacacctctggcaaccgcaattctgcctacacggagctg
ggagattcatgtgtggacatggagactgacccctcggaggggccagggcttggagaccct
gccgggggcagcaccccaccagctcgtcagggatcctgggaagatgaggaagaagactat
gaagaggagctgactgacaaccggaatcggggccggaataaggcccgctactgtgcggag
ggcgggggaccagtgctgggacgcaacaagaacgagctggagggctggggacgcggtgtt
tacatccgctga

KEGG   Miniopterus natalensis: 107530629
Entry
107530629         CDS       T05883                                 

Gene name
CACNA2D3
Definition
(RefSeq) voltage-dependent calcium channel subunit alpha-2/delta-3
  KO
K04860  voltage-dependent calcium channel alpha-2/delta-3
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna04921  Oxytocin signaling pathway
mna05410  Hypertrophic cardiomyopathy
mna05412  Arrhythmogenic right ventricular cardiomyopathy
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107530629 (CACNA2D3)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107530629 (CACNA2D3)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107530629 (CACNA2D3)
   04261 Adrenergic signaling in cardiomyocytes
    107530629 (CACNA2D3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107530629 (CACNA2D3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107530629 (CACNA2D3)
   05414 Dilated cardiomyopathy
    107530629 (CACNA2D3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107530629 (CACNA2D3)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107530629 (CACNA2D3)
SSDB
Motif
Pfam: VGCC_alpha2 VWA_N VWA_3 VWA dCache_1 VWA_2 dCache_2 Cache_3-Cache_2 VWA_CoxE
Other DBs
NCBI-GeneID: 107530629
NCBI-ProteinID: XP_016059989
LinkDB
Position
Unknown
AA seq 940 aa
MSGRDVHSEDSHYRATGAGKSVTIQLFGDKLFPIAIDPAIVNGVYWSESLNKVFVDNFDR
DPSLIWQYFGSAKGFFRQYPGIKWEPDENGVIAFDCRNRKWYIQAATSPKDVVILVDVSG
SMKGLRLTIAKQTVSSILDTLGDDDFFNIIAYNEELHYVEPCLNGTLVQADRTNKEHFRE
HLDKLFAKGIGMLDIALNEAFNILSDFNHTGQGSICSQAIMLITDGAVDTYDTIFAKYNW
PDRKVRIFTYLIGREAAFADNLKWMACANKGFFTQISTLADVQENVMEYLHVLSRPKVID
QEHDVVWTEAYIDSTLADDQGLVLMTTVAMPVFSKQNETRSKGILLGVVGTDVPVKELLK
TIPKYKLGIHGYAFAITNNGYILTHPELRPLYEEGKKRRKPNYSSVDLSEVEWEDRDDVL
RNAMVNRKTGKFSMEVKKTVDKGKRVLVMTNDYYYTDIKGTPFSLGVALSRGHGKYFFRG
NVTIEEGLHDLEHPDVSLADEWSYCNTDLHPEHRHLSQLEAIKLYLKGKEPLLQCDKELI
QEVLFDAVVSAPIEAYWTSLALNKSENSDKGVEVAFLGTRTGLSRINLFVGAEQLTNQDF
LKAGDKENIFNADHFPLWYRRAAEQIPGSFVYSIPFSTGTVNKSNVVTASTSIQLLDERK
SPVVAAVGIQMKLEFFQRKFWTASRQCASLDGKCSISCDDETVNCYLIDNNGFILVSEDY
TQTGDFFGEVEGAVMNKLLTMGSFKRITLYDYQAMCRANKESSDAAHGLLDPYKAFLAAV
KWIMTELVLFLVEFNLCSWWHSDMTAKAQKLKQTLEPCDTEYPAFVSERTIKETSGNIAC
EDCSKSFVIQQIPSSNLFMVVVDSSCLCESVAPITMAPIEIRYNESLKCERLKAQKIRRR
PESCHGFHPEENARECGGAPSLQAKVGLALFPMLPMLFFR
NT seq 2823 nt   +upstreamnt  +downstreamnt
atgtctgggagggatgtacattctgaggacagtcactacagagcaactggtgctggcaaa
tctgtgacaatccagctgtttggggacaaactcttccccatcgccatcgacccagcgatt
gtcaatggagtttattggtctgaatccctaaacaaagtttttgtggataactttgaccgg
gacccgtctctcatatggcagtactttggaagtgcaaagggctttttcaggcagtatcca
gggattaaatgggaaccagatgagaatggagtcattgcctttgactgcaggaaccgaaaa
tggtacatccaggcagcgacttctccgaaggacgtggtcattttagttgacgtcagtggc
agcatgaaaggcctccgtctgaccatcgccaagcagacggtctcctctattctggacacg
ttgggggatgatgacttcttcaacatcattgcttacaacgaggagcttcactacgtggag
ccgtgcctgaacgggacgctggtgcaggccgacaggacgaacaaggagcacttcagggag
cacctggacaaactttttgccaaaggaatcggcatgctggacatagctctgaacgaggcc
ttcaacatcctcagcgacttcaaccacacgggacaaggaagcatctgcagccaggccatc
atgctcatcacagacggggcagtggacacctatgatacaatctttgcgaaatacaattgg
ccagatcggaaggttcgcatcttcacgtacctcattggacgggaggcggcttttgcagac
aatctcaagtggatggcctgtgccaacaaaggatttttcacccagatctccacgttggcg
gacgtgcaggaaaatgtcatggagtacctccacgtgctgagccggcccaaggtgatcgac
caggagcacgacgtggtgtggaccgaagcttacatcgacagcacccttgctgatgatcag
ggccttgtcctcatgaccacagtcgccatgcccgtgtttagtaagcagaacgaaaccagg
tcgaaaggcattctgctaggcgtggttggcacagatgtcccagtgaaagaacttctgaag
accatccccaaatacaagttggggattcacggctatgcctttgcaatcacaaataatgga
tatatcctgacgcacccagaactcaggccactgtacgaagaaggaaaaaagcgaaggaaa
cccaactacagtagcgttgacctctccgaggtcgagtgggaagacagagatgacgtgtta
cgaaacgccatggtgaaccgaaagacagggaagttttccatggaggtgaagaagacagtg
gacaaagggaaacgggttttggtgatgacaaatgactactattatacagacatcaagggt
actcctttcagtttaggtgtggcgctctccagaggccatgggaagtatttcttccgaggg
aatgtcaccatcgaagaaggcctgcatgacttagaacaccccgacgtgtccttggcagac
gaatggtcctactgcaacacggacctgcacccagagcaccgtcacctgtctcaattagaa
gctattaagctctacctcaaaggcaaagaacctcttctgcaatgtgataaagaactgata
caggaggtcctttttgatgccgtggtgagtgctcccattgaagcctattggaccagcctt
gccctcaacaaatctgagaattcggacaagggcgtggaggtggccttccttggcactcgc
acgggcctctcaaggatcaacctgttcgttggtgctgagcagctcaccaatcaggacttc
ctgaaagctggcgacaaggagaacattttcaatgcagaccatttccctctctggtaccga
agagccgccgagcagatcccggggagcttcgtctactccatccccttcagcacaggaaca
gtcaacaaaagcaatgtggtgacagcaagtacctccatccagctcctggatgaaaggaag
tctcccgtggtggcagctgtaggcattcagatgaaactcgaatttttccaaaggaagttc
tggactgccagcagacagtgcgcctctctggatggcaaatgctccatcagctgcgatgac
gagactgtgaactgttacctcatagacaataacggatttattctggtgtctgaagactac
acacagactggagacttttttggtgaggtcgagggagctgtgatgaacaaattgttaaca
atgggctcctttaaaagaattaccctttacgactatcaggccatgtgcagggccaacaag
gagagcagcgacgccgcccacggcctcctagatccttataaagccttccttgctgcagta
aaatggatcatgacagaacttgtcttgttcctggtggaatttaacctctgcagttggtgg
cactcagatatgacagctaaagcccagaaattgaaacagaccctggagccttgtgatact
gaatatccagcatttgtctctgagcgcaccatcaaggaaacctcagggaacattgcttgt
gaagactgctccaagtcctttgtcatccagcagatccccagcagcaacctgttcatggtg
gtggtggacagcagctgcctctgtgagtccgtggcccccatcaccatggcgcccatcgaa
atcaggtataacgaatctcttaagtgtgaacgtttaaaggcccagaagatcagaaggcgc
ccggagtcttgccatggcttccatcccgaggagaacgccagggagtgcgggggtgcgccc
agcctccaggccaaggtgggcctcgccctcttccccatgctcccgatgctcttcttcagg
tga

KEGG   Miniopterus natalensis: 107530945
Entry
107530945         CDS       T05883                                 

Gene name
CACNG4
Definition
(RefSeq) voltage-dependent calcium channel gamma-4 subunit
  KO
K04869  voltage-dependent calcium channel gamma-4
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna04921  Oxytocin signaling pathway
mna05410  Hypertrophic cardiomyopathy
mna05412  Arrhythmogenic right ventricular cardiomyopathy
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107530945 (CACNG4)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107530945 (CACNG4)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107530945 (CACNG4)
   04261 Adrenergic signaling in cardiomyocytes
    107530945 (CACNG4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107530945 (CACNG4)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107530945 (CACNG4)
   05414 Dilated cardiomyopathy
    107530945 (CACNG4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107530945 (CACNG4)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107530945 (CACNG4)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 AA_permease_2 DUF2269
Other DBs
NCBI-GeneID: 107530945
NCBI-ProteinID: XP_016060369
LinkDB
Position
Unknown
AA seq 297 aa
MGRETSKFLGQLGKQPGSQLIGKRQESTCPELISGYSRLEVPRGIYKGHCFRINHFPEDN
DYDHDSSEYLLRIVRASSVFPILSTILLLLGGLCIGAGRFYSRKNNIVLSAGILFVAAGL
SNIIGIIVYISSNTGDPSDKRDEDKKNHYNYGWSFYFGALSFIVAETVGVLAVNIYIEKN
KELRFKTKREFLKAPSSSPYARMPSYRYRRRRSRSSSRSTEASPSRDTSPVGLKIAGAIP
MGELSMYTLSREPLKVTTAATYSPGQEASFLQVHDFFQQDLKEGLHVSMLNRRTTPV
NT seq 894 nt   +upstreamnt  +downstreamnt
atgggcagagaaacatccaaattcttgggacagctcgggaagcagccaggaagccagcta
attggtaaacgacaggagagcacgtgccctgagctcatcagtggctactcccgattagag
gtgccaagagggatctataaagggcactgcttccggatcaatcacttcccagaggacaac
gactatgaccacgacagctcggagtatctccttcgcatcgtgcgcgcctccagcgtcttc
cccatcctcagcaccatcctgctgctgctcggcgggctctgcatcggcgccgggaggttc
tacagccgcaagaacaacatcgtcctcagtgccggcatcctcttcgtggctgcaggcctc
agtaacatcataggcatcatcgtctacatttccagcaacacgggcgacccaagcgacaag
cgcgacgaagacaagaaaaaccattacaactacggctggtctttttactttggagccctg
tccttcattgtggccgagaccgtgggcgtcctggccgtgaacatttacattgagaaaaat
aaagagttgcgatttaagaccaaacgggagttcctcaaggccccgtcctcctcgccctac
gccaggatgcccagctacaggtaccggcgacggcgctcccggtccagctccaggtccacg
gaggcctcgccctccagggacacgtcgccggtgggcctgaagatcgcgggggccatcccc
atgggcgagctgtccatgtacacgctgtcccgggagcccctcaaggtgaccacggctgcc
acctacagcccgggccaggaggccagcttcctgcaggtgcacgacttcttccagcaggac
ctgaaggaaggcttgcatgtgagcatgctgaaccggcggaccacccccgtgtga

KEGG   Miniopterus natalensis: 107531121
Entry
107531121         CDS       T05883                                 

Gene name
CACNG1
Definition
(RefSeq) voltage-dependent calcium channel gamma-1 subunit
  KO
K04866  voltage-dependent calcium channel gamma-1
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna04921  Oxytocin signaling pathway
mna05410  Hypertrophic cardiomyopathy
mna05412  Arrhythmogenic right ventricular cardiomyopathy
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107531121 (CACNG1)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107531121 (CACNG1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107531121 (CACNG1)
   04261 Adrenergic signaling in cardiomyocytes
    107531121 (CACNG1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107531121 (CACNG1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107531121 (CACNG1)
   05414 Dilated cardiomyopathy
    107531121 (CACNG1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107531121 (CACNG1)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107531121 (CACNG1)
SSDB
Motif
Pfam: Claudin_2 PMP22_Claudin DUF981 PDR_assoc
Other DBs
NCBI-GeneID: 107531121
NCBI-ProteinID: XP_016060608
LinkDB
Position
Unknown
AA seq 224 aa
MSQTKTLKVRVTLFCILVGIVLATVAVVSDHWAVLSPQVEHLSAVCEAAHFGLWRICTKS
IIVSDSKDKSCGPITLPGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAISIFSLVFI
ILGTICVLLSFSRKRDYLLRPASMFYTFAGLCIFVSVEVLRQSVKRMIASEDTVWIQYYY
SWSFACACSAFVFLFLGGLALLLFSLPRMPQNPWESCMDSEPEH
NT seq 675 nt   +upstreamnt  +downstreamnt
atgtcccagaccaaaacactgaaggtccgcgtgacgctcttctgcatcctggtgggcatc
gtgctggccacggtggccgtggtgagcgaccactgggccgtgctgagcccccaggtggag
cacctcagcgccgtctgtgaggcagcccacttcggcctctggcggatttgcaccaagagt
atcatcgtgagcgacagcaaggacaagagctgcggacccatcaccctgcctggggagaaa
aactgttcctacttcaggcactttaacccaggcgagagctcggagatcttcgaattcacc
actcagaaagagtacagcatctcggctgcagccatctccatcttcagcctggtcttcatc
atcctggggaccatctgcgtgctcctgtccttcagcaggaagcgggattacctgctgagg
ccggcctccatgttctacaccttcgcaggcctctgcatcttcgtctcggtggaggtcctg
cggcagtcggtgaagcgcatgatcgccagcgaggacaccgtctggatccagtactactac
tcctggtccttcgcctgcgcctgctcggccttcgtcttcctcttcctgggcggcctcgcc
ctcctcctcttctccctgcctcggatgccccagaacccctgggagtcctgcatggactcc
gagcccgagcactag

KEGG   Miniopterus natalensis: 107531651
Entry
107531651         CDS       T05883                                 

Gene name
CACNB4
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit beta-4 isoform X1
  KO
K04865  voltage-dependent calcium channel beta-4
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna04921  Oxytocin signaling pathway
mna05410  Hypertrophic cardiomyopathy
mna05412  Arrhythmogenic right ventricular cardiomyopathy
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107531651 (CACNB4)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107531651 (CACNB4)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107531651 (CACNB4)
   04261 Adrenergic signaling in cardiomyocytes
    107531651 (CACNB4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107531651 (CACNB4)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107531651 (CACNB4)
   05414 Dilated cardiomyopathy
    107531651 (CACNB4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107531651 (CACNB4)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107531651 (CACNB4)
SSDB
Motif
Pfam: Guanylate_kin VGCC_beta4Aa_N SH3_1 SH3_2 SH3_9
Other DBs
NCBI-GeneID: 107531651
NCBI-ProteinID: XP_016061244
LinkDB
Position
Unknown
AA seq 407 aa
MYDNLYLHGIEDSEAGSADSYTSRPSDSDVSLEEDREAIRQEREQQAAIQLERAKSKPVA
FAVKTNVSYCGALDEDVPVPSTAISFDAKDFLHIKEKYNNDWWIGRLVKEGCEIGFIPSP
LRLENIRIQQEQKRGRFHGGISITRVTADISLAKRSVLNNPSKRAIIERSNTRSSLAEVQ
SEIERIFELARSLQLVVLDADTINHPAQLIKTSLAPIIVHVKVSSPKVLQRLIKSRGKSQ
SKHLNVQLVAADKLAQCPPEMFDVILDENQLEDACEHLGEYLEAYWRATHTTSSTPMTPL
LGRNLGSTALSPYPTAISGLQSQRVRHSNHSTENSPIERRSLMTADENYHNERARKSRNR
LSSSSQHSRDHYPLVEEDYPDSYQDSYKPHRNRGSPGGYSHDSRHRL
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgtatgacaatttgtacctgcatggcattgaagactcggaggctggttcagcggattcc
tacacaagcaggccgtctgactccgatgtctccttggaagaagacagggaagcgatccgg
caggagagagagcagcaggcggccatccagctggagagagcgaagtccaagcctgtagcc
tttgctgtgaagacaaacgtgagctactgcggcgccctggatgaagatgtgcctgtcccc
agcacggccatctccttcgatgccaaggactttctacacattaaagagaaatacaacaat
gattggtggataggaaggctggtgaaggagggctgtgagattggcttcatcccaagtcca
cttaggctggagaacatccggattcagcaagaacagaaaaggggacgttttcacggaggg
atatcaataacgagagtgacagctgacatttctcttgctaagaggtctgtcctaaataat
cccagcaagagagcaataattgaacgttcgaacactcggtccagcctagcggaagtacaa
agtgaaattgaaagaatctttgagttggcaagatctttgcaactggttgttcttgatgca
gacaccatcaatcacccagcacaacttataaagacttctttagcaccaattattgttcac
gtaaaagtctcatctccaaaggttttacagcggttgattaaatctagaggaaaatcccaa
agtaaacacttaaatgtgcaactggtggcagctgataaactcgcacaatgccccccagaa
atgtttgatgttatattggatgaaaaccagctggaggatgcgtgtgagcacctgggagag
tacctggaggcatactggcgtgccacccacacaacaagtagcacccctatgaccccgctg
ctcggcaggaatttgggctccacagcgctctccccatatcccacagcgatttctgggtta
cagagtcagcgtgtgaggcacagcaaccattccacagagaactctccaattgaaagacga
agtcttatgaccgctgatgaaaattatcacaatgaaagggctcggaagagtaggaatcgc
ttgtcttccagttcccagcatagccgagatcattaccctcttgtggaagaagattaccct
gactcataccaggactcttacaaaccccacaggaaccgaggatcgcctgggggctatagc
catgactcccggcataggctttga

KEGG   Miniopterus natalensis: 107534931
Entry
107534931         CDS       T05883                                 

Gene name
CACNA1D
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1D isoform X1
  KO
K04851  voltage-dependent calcium channel L type alpha-1D
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04020  Calcium signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04218  Cellular senescence
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna04270  Vascular smooth muscle contraction
mna04530  Tight junction
mna04713  Circadian entrainment
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna04728  Dopaminergic synapse
mna04911  Insulin secretion
mna04912  GnRH signaling pathway
mna04921  Oxytocin signaling pathway
mna04924  Renin secretion
mna04925  Aldosterone synthesis and secretion
mna04927  Cortisol synthesis and secretion
mna04929  GnRH secretion
mna04930  Type II diabetes mellitus
mna04934  Cushing syndrome
mna04935  Growth hormone synthesis, secretion and action
mna04973  Carbohydrate digestion and absorption
mna05010  Alzheimer disease
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05031  Amphetamine addiction
mna05410  Hypertrophic cardiomyopathy
mna05412  Arrhythmogenic right ventricular cardiomyopathy
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107534931 (CACNA1D)
   04020 Calcium signaling pathway
    107534931 (CACNA1D)
   04024 cAMP signaling pathway
    107534931 (CACNA1D)
   04022 cGMP-PKG signaling pathway
    107534931 (CACNA1D)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107534931 (CACNA1D)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107534931 (CACNA1D)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107534931 (CACNA1D)
   04929 GnRH secretion
    107534931 (CACNA1D)
   04912 GnRH signaling pathway
    107534931 (CACNA1D)
   04921 Oxytocin signaling pathway
    107534931 (CACNA1D)
   04935 Growth hormone synthesis, secretion and action
    107534931 (CACNA1D)
   04924 Renin secretion
    107534931 (CACNA1D)
   04925 Aldosterone synthesis and secretion
    107534931 (CACNA1D)
   04927 Cortisol synthesis and secretion
    107534931 (CACNA1D)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107534931 (CACNA1D)
   04261 Adrenergic signaling in cardiomyocytes
    107534931 (CACNA1D)
   04270 Vascular smooth muscle contraction
    107534931 (CACNA1D)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    107534931 (CACNA1D)
  09156 Nervous system
   04724 Glutamatergic synapse
    107534931 (CACNA1D)
   04727 GABAergic synapse
    107534931 (CACNA1D)
   04725 Cholinergic synapse
    107534931 (CACNA1D)
   04728 Dopaminergic synapse
    107534931 (CACNA1D)
   04726 Serotonergic synapse
    107534931 (CACNA1D)
   04723 Retrograde endocannabinoid signaling
    107534931 (CACNA1D)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107534931 (CACNA1D)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107534931 (CACNA1D)
   05020 Prion disease
    107534931 (CACNA1D)
   05022 Pathways of neurodegeneration - multiple diseases
    107534931 (CACNA1D)
  09165 Substance dependence
   05031 Amphetamine addiction
    107534931 (CACNA1D)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107534931 (CACNA1D)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107534931 (CACNA1D)
   05414 Dilated cardiomyopathy
    107534931 (CACNA1D)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107534931 (CACNA1D)
   04934 Cushing syndrome
    107534931 (CACNA1D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107534931 (CACNA1D)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107534931 (CACNA1D)
SSDB
Motif
Pfam: Ion_trans CAC1F_C Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 107534931
NCBI-ProteinID: XP_016065693
LinkDB
Position
Unknown
AA seq 2089 aa
MSTSAPPPVGSLSQRKRQQYAKSKKQGNSSNSRPARALFCLSLNNPIRRACISIVEWKPF
DIFILLAIFANCVALAIYIPFPEDDSNSTNHNLEKVEYAFLIIFTVETFLKIIAYGLLLH
PNAYVRNGWNLLDFVIVIVGLFSVILEQLTKETEGGNHSGGKSGGFDVKALRAFRVLRPL
RLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHKTCFFADSDI
VAEEDPAPCAFSGNGRQCIVNGTECRSGWVGPNGGITNFDNFAFAMLTVFQCITMEGWTD
VLYWMNDAMGFELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREK
QQLEEDLKGYLDWITQAEDIDPENEEEGGEESKRNTSMPTSETESVNTENVSGEGENQGC
WGTLCQAISKSKLSRRWRRWNRFSRRRCRAAVKSVTFYWLVIVLVFLNTLTISSEHYNQP
DWLTQVQDIANKVLLAMFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGITETILVELE
IMSPLGISVFRCVRLLRIFKVTRHWTSLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLG
MQLFGGKFNFDETQTKRSTFDNFPQALLTVFQILTGEDWNAVMYDGIMAYGGPSSSGMIV
CIYFIILFICGNYILLNVFLAIAVDNLADAESLNTAQKEEAEEKERKKIARKESLENKKN
KPEVNQMANSDNKVTVDDYQEEEEDKDPYPPCDVPVAEEEEEEEEEEPEVPAGPRPRRIS
ELNMKEKIVPIPEGSAFFILSKTNPIRVGCHKLINHHVFTNLILVFIMLSSASLAAEDPI
RSHSFRNTILGYFDYAFTAIFTVEILLKMTTFGAFLHKGAFCRNYFNLLDMLVVGVSLVS
FGIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMF
ACIGVQLFKGKFYRCTDEAKSNPEECRGLFIFYKDGEVDNPVVRERIWQNSDFNFDNVLS
AMMALFTVSTFEGWPDLLYKAIDSHGENVGPIYNYRVEISIFFIIYIIIVAFFMMNIFVG
FVIVTFQEQGEKEYKNCELDKNQRQCVEYALKARPVRRYIPKNPYQYKFWYVVNSSPFEY
MMFVLIMLNTLCLAMQHYEQSKMFNDAMDILNMVFTGVFTVEMVLKVIAFKPKGYFSDAW
NTFDSLIVIGSIIDVALSEADPTESENVPVPTAPPGNSEESNRISITFFRLFRVMRLVKL
LSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQMFGKVAMRDNNQINRNNNF
QTFPQAVLLLFRCATGEAWQEIMLACLPGKLCDPESDYNPGEEYSCGSNFAIVYFISFYM
LCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPEAKGRIKHLDVVTLL
RRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTALKIKTEGNLEQA
NEELRAVIKKIWKKTSMKLLDQVVPPAGDDEVTVGKFYATFLIQDYFRKFKKRKEQGLVG
KYPAKNTTIALQAGLRTLHDIGPEIRRAISCDLQDDEPEETKEEEDVVKRNGALLGNHVN
HVNSDRRDSLQQTNTTHRPLHVQRPSIPPASDTEKPLFPPAGNSVCHNHHNHNSIGKQAP
SSTNANLNNANMSKAAPGKRPSNGNLEHVSENGHDSSHKHDHEPQRRSSIKRARYYETYI
RSDSGDEQFPTICREDPEIQGYFRDPCYLGEPEYFSGEEDYEDSSPTSSRQNYSYYSRHP
GSSVDFERPRGYHHPQDFLEDSDSPVCYDSRRSPRRRLLPPTPTSHRRSSFNFECLRRQS
SQEEFPPSPTFPHRTALPLHLMQQQIMAVAGLDSSKAQKYSPSHSTRSWATPPATPPYQD
WTPCYTPLIQVEQTEALDQVNGSLPSLHRSSWYTDEPGISYRTFTPASLTVPSSFHNKNS
DKQRSADSLVEAVLISEGLGRYARDPKFVCATKHEIADACDLTIDEMESAASNLLNGTVH
PRANGDVGPISGQQDYELQDFGPGYSDEEPDPGREEEDLADEMICITTL
NT seq 6270 nt   +upstreamnt  +downstreamnt
atgagcacctccgcacccccacctgtaggatctctctcccaaagaaaacgtcagcaatac
gccaagagcaaaaaacagggtaactcgtctaacagccgacctgcccgagccctcttctgt
ttatcactcaataaccccatccgaagagcctgcattagtatagtggaatggaaaccattt
gacatatttatattattggctatttttgccaattgtgtggccttagctatttacatccca
tttcctgaagatgattctaattcaacaaatcataacttggaaaaagtagaatatgccttc
ctgattatttttacagtcgagacatttttgaagattatagcgtatggattattgctacat
cctaatgcttatgttaggaatggatggaatttactggattttgttatagtaatagtagga
ttgtttagtgtaattttggaacaattaaccaaagaaacagaaggcggcaaccactctggt
ggcaaatcgggaggctttgatgtcaaagccctccgtgccttccgagtgctacgaccactt
cgactagtatcaggagtgcccagtttacaagttgtcctgaactccattataaaagccatg
gtccccctcctgcacatagcccttttggtgttatttgtaatcataatctatgctattata
ggattggaactttttattggaaaaatgcacaaaacatgtttttttgctgactcagatatc
gtagctgaagaggacccagcgccgtgtgcgttctcagggaatggacgccagtgtatcgtc
aacggcacagagtgtaggagtggctgggttggcccaaacggaggcatcaccaactttgat
aactttgcctttgctatgctcaccgtgtttcagtgcatcaccatggagggctggacagac
gtgctctactggatgaatgatgctatgggatttgaattgccctgggtgtattttgtcagt
ctcgtcatctttgggtcatttttcgtactaaatcttgtacttggtgtattgagcggagaa
ttctccaaggaaagagagaaagcaaaagcccggggagatttccagaaactccgggagaag
cagcagcttgaagaggacctgaagggctacttggattggattacccaagcagaagacatt
gaccctgagaatgaggaggagggaggagaggaaagcaagcgaaacaccagcatgccgacc
agcgagacggaatctgtgaacacggagaacgtaagtggcgaaggcgagaaccaaggctgc
tggggaactctctgtcaagccatctcaaaatccaagctcagccgccgctggcgtcgctgg
aaccgattcagtcgcagaagatgcagggcggccgtgaagtctgtcacgttctactggctg
gttattgtcttggtgtttctcaacaccttaaccatttcctccgagcactacaaccagcct
gactggttgacgcaggttcaagatatcgcgaacaaagtcctcctggctatgttcacctgc
gagatgctggtgaagatgtacagcctgggcctccaggcgtatttcgtctctctctttaac
cggtttgattgtttcgtggtgtgtggtggaattacggaaacgatcttggtggaactggaa
atcatgtctcccctggggatctccgtgtttcgctgtgtgcgcctcttacggattttcaaa
gtgaccaggcactggacatccctgagcaacttggtggcatcgctgttaaactccatgaag
tccatcgcgtcgctgctgcttctgcttttcctcttcatcatcatcttctccttgcttggg
atgcagctgtttggaggcaagtttaacttcgatgagacacagaccaagcggagcaccttc
gacaatttccctcaagcgctgctgacagtgttccagattctgacaggtgaagactggaat
gctgtgatgtatgatggcatcatggcctacgggggcccgtcgtcttcgggcatgatcgtc
tgcatctacttcatcattctcttcatttgcgggaactatattctactgaatgtcttcttg
gccatcgctgtagacaatttggctgatgctgaaagtttgaatactgctcagaaagaggaa
gctgaagaaaaggaaaggaaaaagattgccagaaaagaaagcctggaaaataaaaagaac
aagccggaagtcaaccagatggccaacagtgacaacaaggttacagtcgatgactaccaa
gaagaagaagaagacaaggacccctatccaccttgcgatgtgccagtagctgaagaggaa
gaagaggaggaggaggaggagcctgaggtccctgccgggccccgtcctcgtagaatctca
gagctgaacatgaaagagaagatcgtccccattcctgaagggagcgctttcttcatcctc
agcaagaccaacccgatccgcgtgggctgccacaagctcatcaaccatcatgtcttcacc
aacctcatcctggtcttcatcatgctcagcagcgcgtccctggccgccgaggaccccatc
cgaagccactccttccggaacactatactgggttactttgactatgctttcacagccatc
tttactgttgaaatcctgttaaagatgacgacctttggagctttcctccacaaaggggcc
ttctgcaggaactacttcaacctgctggatatgctggtggtcggggtgtctctggtgtca
tttgggatccaatccagtgccatctccgttgtgaagattctcagggtcttaagggtcctg
aggccgctcagggcaatcaacagagcgaaaggactgaagcacgtcgtccagtgcgtcttt
gtggccatccggacaatcggcaacatcatgatcgtcaccacccttctgcagttcatgttt
gcctgcatcggggtccagttgttcaagggaaagttctatcgctgcacagatgaagccaaa
agtaaccccgaagaatgcagggggcttttcatattctacaaggatggggaggttgataac
cctgtggtccgtgagaggatctggcaaaatagcgatttcaactttgacaatgtcctttcg
gctatgatggcactgttcacggtctccacgtttgagggctggcctgatttgctgtacaaa
gccatcgactcgcacggagagaacgtcggcccgatctacaactaccgcgtagagatctcc
atcttcttcatcatctacatcatcatcgtcgctttcttcatgatgaacatcttcgtgggt
ttcgtcattgtcacattccaggagcagggagaaaaagagtataagaactgtgagctggac
aaaaatcagcgtcagtgtgtggaatacgccttgaaagcgcgccctgtgcggagatacatc
cccaaaaacccctaccagtacaagttctggtatgtggtgaactcctcgccgttcgaatac
atgatgtttgtcctcatcatgctcaacacactctgcttggccatgcagcactacgagcag
tccaagatgtttaatgacgccatggacattctgaacatggtcttcaccggggtgttcact
gtcgagatggttttgaaagtcattgcgtttaaacctaaggggtattttagtgacgcctgg
aatacgtttgactccctcatcgtaatcggcagcattatagacgtggccctcagcgaagct
gacccaactgaaagtgagaatgtccctgtcccaactgctccacctgggaactctgaagag
agcaatagaatctccatcacctttttccgtcttttccgagtgatgcgattggtgaagctt
ctcagcaggggggaaggcatccggaccttgctgtggacttttattaagtcttttcaggcg
ctcccgtatgtcgccctcctcatagccatgctgttcttcatctacgcggttattggcatg
cagatgtttgggaaagttgccatgagagataacaaccagatcaacaggaacaataacttc
cagacctttccccaggcggtgttgctgctcttcaggtgtgcgacaggtgaggcctggcag
gagatcatgctggcctgcctccccggcaagctctgcgaccccgagtcggattacaaccct
ggggaggagtactcgtgtgggagcaactttgccatcgtgtacttcatcagtttttacatg
ctctgcgcatttctgatcatcaacctgtttgtggcggtcatcatggataattttgattat
ctgacccgggactggtctattctgggacctcaccatttagatgaattcaagaggatatgg
tcagaatatgaccctgaggctaagggaaggatcaagcaccttgacgtggtcaccctgctc
cgccgcatccagcctcccctggggtttgggaagttatgcccacacagagtcgcctgtaag
agactagttgccatgaacatgcctctcaacagcgatgggacagtcatgtttaatgcaacc
ctgtttgctttggttcgaacagctctaaaaatcaagacggaagggaacctggaacaagca
aacgaagaactccgagctgtgataaagaaaatctggaagaaaaccagcatgaagctactt
gaccaagttgtccctccagctggtgatgatgaggtaaccgtggggaagttctatgccact
ttcctgatacaggactactttaggaaattcaagaaacggaaagaacaaggactggtggga
aagtaccctgcgaagaacaccacaattgccctacaggcggggttaaggacactgcacgac
atcgggccagagatccggcgggctatatcatgtgatctgcaggacgatgagcctgaggaa
accaaagaggaagaagatgtagtcaaaagaaatggtgccctgcttggaaaccatgtcaat
catgttaatagtgataggagagattcccttcagcagaccaataccacccaccgtcccctg
catgtccaaaggccttcaattccacctgcaagtgatactgagaaaccgctgtttcctcca
gcaggaaattcggtgtgtcataaccatcataaccataattccataggaaagcaagctccc
agctcaacaaatgccaatctcaataatgccaatatgtccaaagctgcccctggaaagcgg
cccagcaatgggaaccttgagcatgtgtctgaaaatgggcatgattcctcccacaagcat
gaccatgagcctcaaagaaggtccagtattaaaagagcccgctattatgagacttacatt
aggtccgactcaggagatgagcagtttccaactatttgccgggaagacccggagatacag
ggttacttcagggacccctgctacttgggggagccggagtacttcagtggtgaggaggac
tacgaggacagctcgccgacctccagcaggcagaactacagctattacagccgacaccca
ggcagcagcgtggacttcgagcggccccgaggctaccatcacccccaagacttcttggag
gacagtgactcacccgtttgctatgattcccggagatctccaaggagacgcctactacct
cccactccaacatcccaccggagatcctccttcaactttgagtgcctgcgccggcagagc
agccaggaggagttcccaccgtcccctaccttcccccaccgcacagccctgcctctgcac
ctgatgcagcaacagatcatggcagtcgcaggcctagattcaagtaaagcccagaagtac
tcgccgagccactccacccggtcgtgggccacccctccagcgacccctccttaccaggac
tggacgccgtgctacacccccctgatccaggtggagcagacggaggccctggaccaggtc
aacggcagcctgccatccctgcaccgcagctcgtggtacacagacgagcctggcatctcc
tatcggaccttcacaccagccagtctgactgtccccagcagtttccacaacaaaaacagt
gacaagcagaggagcgcagacagcttggtggaggcagtcctgatatccgaaggcttagga
cggtatgcaagggacccaaaattcgtgtgtgcgacaaaacacgaaatcgctgatgcctgt
gacctaaccatcgacgagatggagagtgcagccagcaacctgcttaatgggacggtgcat
ccccgggcgaacggcgacgtgggccccatctcaggccagcaggactacgagctccaggac
ttcgggcccggctacagtgacgaagagccagaccccgggagggaggaggaggacctggca
gatgaaatgatctgcatcaccaccctgtag

KEGG   Miniopterus natalensis: 107536018
Entry
107536018         CDS       T05883                                 

Gene name
CACNA1S
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1S
  KO
K04857  voltage-dependent calcium channel L type alpha-1S
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04020  Calcium signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna04270  Vascular smooth muscle contraction
mna04723  Retrograde endocannabinoid signaling
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna04911  Insulin secretion
mna04912  GnRH signaling pathway
mna04921  Oxytocin signaling pathway
mna04924  Renin secretion
mna04925  Aldosterone synthesis and secretion
mna04927  Cortisol synthesis and secretion
mna04929  GnRH secretion
mna04934  Cushing syndrome
mna04935  Growth hormone synthesis, secretion and action
mna05010  Alzheimer disease
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05410  Hypertrophic cardiomyopathy
mna05412  Arrhythmogenic right ventricular cardiomyopathy
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107536018 (CACNA1S)
   04020 Calcium signaling pathway
    107536018 (CACNA1S)
   04024 cAMP signaling pathway
    107536018 (CACNA1S)
   04022 cGMP-PKG signaling pathway
    107536018 (CACNA1S)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107536018 (CACNA1S)
   04929 GnRH secretion
    107536018 (CACNA1S)
   04912 GnRH signaling pathway
    107536018 (CACNA1S)
   04921 Oxytocin signaling pathway
    107536018 (CACNA1S)
   04935 Growth hormone synthesis, secretion and action
    107536018 (CACNA1S)
   04924 Renin secretion
    107536018 (CACNA1S)
   04925 Aldosterone synthesis and secretion
    107536018 (CACNA1S)
   04927 Cortisol synthesis and secretion
    107536018 (CACNA1S)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107536018 (CACNA1S)
   04261 Adrenergic signaling in cardiomyocytes
    107536018 (CACNA1S)
   04270 Vascular smooth muscle contraction
    107536018 (CACNA1S)
  09156 Nervous system
   04727 GABAergic synapse
    107536018 (CACNA1S)
   04725 Cholinergic synapse
    107536018 (CACNA1S)
   04726 Serotonergic synapse
    107536018 (CACNA1S)
   04723 Retrograde endocannabinoid signaling
    107536018 (CACNA1S)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107536018 (CACNA1S)
   05020 Prion disease
    107536018 (CACNA1S)
   05022 Pathways of neurodegeneration - multiple diseases
    107536018 (CACNA1S)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107536018 (CACNA1S)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107536018 (CACNA1S)
   05414 Dilated cardiomyopathy
    107536018 (CACNA1S)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107536018 (CACNA1S)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107536018 (CACNA1S)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107536018 (CACNA1S)
SSDB
Motif
Pfam: Ion_trans GPHH Ca_chan_IQ PKD_channel CAC1F_C
Other DBs
NCBI-GeneID: 107536018
NCBI-ProteinID: XP_016067108
LinkDB
Position
Unknown
AA seq 1881 aa
MEPSSPQDEGLRKKQPKKPVPEILPRPPRALLCLTLQNPLRKACISIVEWKPFETIILLT
IFANCVALAVYLPMPEDDNYSLNIGLEKLEYFFLIVFSIEAAMKIIAYGFLFHPDAYLRS
GWNVLDFIIVFLGVFTVILEQVNVIQSSTTPLGSKGAGLDVKALRAFRVLRPLRLVSGVP
SLQVVLNSIFKAMLPLFHIALLVLFMVTIYAIIGLELFKGKMHKTCYFIGTDIVATEENE
KPSPCARTGSGRPCTINGSECRGGWPGPNHGITHFDNFGFSMLTVYQCITMEGWTDVLYW
VNDAIGNEWPWIYFVTLILLGSFFILNLVLGVLSGXFTKEREKAKSRGTFQKLREKQQLD
EDLRGYMSWITQGEVMDVEDFREGKLSLDEGGSDTESLYEIEGLNKIIQFVRHWRQWNRI
FRWKCHDVVKSRVFYWLVILIVALNTLSIASEHHNQPLWLTHLQDVANRVLLSLFTIEML
MKMYGLGLRQYFMSIFNRFDCFVVCSGILEILLVESGAMSPLGISVLRCIRLLRLFKITK
YWTSLSNLVASLLNSIRSIASLLLLLFLFIVIFALLGMQLFGGRYDFEDTEVRRSNFDNF
PQALISVFQVLTGEDWNSVMYNGILAYGGPSYPGMLVCIYFIILFVCGNYILLNVFLAIA
VDNLAEAESLTSAQKAKAEERKRRKMSKGLPDRPEEEKAVVAKKLDQKPKGEGIPTTAKL
KIDEFESNVNEVKDPYPSADFPGDDEEDEPEIPASPRPRPLAELQLKEKAVPIPEASSFF
IFSPTNKIRVLCHRIVNATWFTNFILLFIMLSSAALAAEDPIRAESMRNQILGYFDIAFT
SVFTVEIVLKMTTYGAFLHKGSFCRNYFNILDLLVVAVSLISMGLQSSSISVVKILRVLR
VLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVLVTTLLQFIFACVGVQLFKGKFFSCNDL
SKMTEKECRGYYYVYKDGDPTQIELHRREWTHNEFHFDNVLSAMMSLFTVSTFEGWPQLL
YKAIDAYEEDRGPVYNHRVEMAIFFIVYIILIAFFMMNIFVGFVIVTFQEQGETEYKNCE
LDKNQRQCVQYALKARPLKCYIPKNPYQYQVWYVVTSSYFEYLMFALIMLNTICLGMQHY
NQSEQMNQISDILNVAFTIIFTLEMILKLMAFKARGYFGDPWNVFDFLIVIGSIIDVILS
EIDTFLASSGGLYCLGGGCGTVDPDESARISSAFFRLFRVMRLIKLLSRAEGVRTLLWTF
IKSFQALPYVALLIVMLFFIYAVIGMQMFGKIALVDGTQINRNNNFQTFPQAVLLLFRCA
TGEAWQEVLLASSYGKLCDPESEYAPGEEYSCGTNFAYYYFISFYMLCAFLIINLFVAVI
MDNFDYLTRDWSILGPHHLDEFKAIWAEYDPEATGRIKHLDVVTLLRRIQPPLGFGKFCP
HRVACKRLVGMNMPLNSDGTVTFNATLFALVRTALKIKTEGNFEQANEELRAIIKKIWKR
TSMKLLDQVIPPIGDDEVTVGKFYATFLIQEHFRKFMKRQEEYYGYRPKKDAVQIQAGLR
TIEEEAAPEIRRTISGDLTAEEELERAMVEAAMEEGIFRRTGGLFGQMDNFLDRANSLAP
VMANQRPLQFSEIEMEELESPVFLEDFPQDPGTNPLARANTNNANANVAAGNSNHSNSQV
FPSARYEQESPGETEPPTARGGVLGQSLLSLLPSPYPPTGPRSQSCVEKQESQLTQRAVP
RAQASPAPCQYSRAESPMPEARRSPMPGPLPQEAPHSRRTPESPSRCLAPATALLIQEAL
LRGGLDTLAADAGFITATGQALAEACQMEPEDVEVAATELLRRRESPEGTAGALGPPSLR
SSLGSLDTCQGSQETLIPPRP
NT seq 5646 nt   +upstreamnt  +downstreamnt
atggagccgtcctccccccaggacgagggcctgaggaagaaacagcccaagaagccggtc
cccgagatcctgcccaggcccccccgggctttgctgtgcctgactctccagaacccgctg
aggaaggcctgcatcagcatcgtcgagtggaaacccttcgagaccatcatcttgctgacc
atctttgccaactgcgtggccctggccgtgtacctgcccatgcccgaggatgacaactac
tctctgaacattggcctggagaagctggagtatttcttcctgattgtcttctccatcgaa
gccgccatgaagatcatcgcctatgggttcctcttccaccccgacgcctacctgcgcagc
ggctggaatgtgctggatttcatcattgtcttcctgggggtcttcacagtgatcctggag
caggtgaatgtcatccagagcagcaccaccccgctgggcagcaaaggggccggcctggac
gtcaaggcgctgagggccttccgcgtgctcagacccctccggctggtgtcgggggtgccc
agcctgcaggtcgtcctcaactccatcttcaaggccatgctgccgctgttccacatcgcc
ctgctggtcctcttcatggtcaccatctacgccatcatcgggctggagctcttcaagggc
aagatgcacaagacgtgctacttcatcggcaccgacatcgtggccacggaagaaaacgag
aagccgtctccctgcgccaggacgggctcaggccgcccctgcaccatcaacggcagcgag
tgccggggtggctggccggggcccaaccacggcatcacgcactttgacaacttcggcttc
tccatgctcaccgtgtaccaatgcatcaccatggagggctggaccgacgtcctgtactgg
gtcaacgatgccatcgggaacgagtggccctggatctactttgtcactctcattctgctg
gggtccttcttcattctcaacctggtgctgggagtcctgagcggnnnnttcaccaaggag
cgggagaaggccaagtcccggggcaccttccagaagctccgggagaagcagcagctcgac
gaggacctgcgcggctacatgagctggatcacgcagggcgaggtcatggacgtggaggac
tttcgagaaggaaagctgtctttggacgaaggaggctccgacactgagagcctgtatgag
atcgagggtttgaacaaaattatccagtttgtccgacactggaggcagtggaaccgcatc
ttccgctggaagtgccatgacgtggtcaagtccagagtcttctactggctggtgatcctg
atcgtggccctcaacaccttgtccattgcctctgagcaccacaaccagccgctgtggttg
actcacctgcaagacgttgccaaccgggtgctgctgtccctcttcaccatcgagatgctg
atgaagatgtacgggctgggcctgcgccagtacttcatgtccatcttcaaccgcttcgac
tgcttcgtggtgtgcagcggcatcctggagatcctgctggtggagtcgggcgccatgagc
cccctgggcatctcagtgctgcgctgcatccgcctcctgaggctcttcaagatcaccaag
tactggacgtcgctgagcaacctggtggcgtccctgctcaactccatccgctccatcgcc
tcgctgctgctgctgctgttcctcttcattgtcatctttgccctgctgggcatgcagctc
ttcgggggccggtacgacttcgaggacaccgaggtgcggcgcagcaacttcgacaacttc
ccgcaggccctcatcagtgtcttccaggtcctgacgggcgaggactggaactcggtgatg
tacaacggcatcctggcctacggcgggccctcctaccccggcatgctcgtgtgcatatac
ttcatcattctcttcgtctgcggcaactatattctgctcaatgtcttcctggccatcgcc
gtggacaacctggctgaggcggagagcctgacttccgcccagaaggccaaggccgaggag
agaaagcgcaggaagatgtctaaggggctcccagacaggcccgaggaggagaaggcagtg
gtggccaagaagctggaccagaagcccaaaggcgaggggattcccaccaccgccaagcta
aaaatcgacgaattcgagtccaacgtcaatgaggtgaaggacccctacccctccgctgac
ttcccaggcgacgatgaagaagatgagcccgagatccccgcgagcccccgcccgcggccg
ctggccgagctgcagctgaaggagaaggcggtgcccatccccgaagccagctctttcttc
atcttcagccccaccaataagattcgcgtcctatgtcatcgcatcgtcaacgccacctgg
ttcaccaacttcatcctgctgttcatcatgctcagcagcgccgcgctggccgccgaggac
cccatccgggccgagtccatgaggaatcagatcctcgggtattttgacattgcattcacc
tctgtcttcactgtggagattgtcctcaagatgaccacttacggcgctttcctgcacaag
ggctccttctgccgcaactacttcaacatcctggacctgctggtggtggccgtgtccctc
atctccatgggactccagtccagctccatctctgtggtgaagatcctcagggtgctgagg
gtgctccgacccctgcgagccatcaacagagccaaggggctgaagcacgtggtacagtgc
gtgttcgtggccatccgcaccatcggcaacatcgtcctggtcaccaccctcctgcagttc
atttttgcctgcgtcggggtccagctcttcaagggcaagttcttcagctgcaacgacttg
tccaagatgaccgagaaggagtgcaggggctattactacgtgtataaggacggggacccc
acacagatagagctgcatcgccgcgagtggacacacaacgaattccactttgacaacgtg
ctgtcagccatgatgtccctcttcacagtctccaccttcgaggggtggccacagctcctg
tacaaggccatcgacgcttacgaggaggacaggggccccgtgtacaaccaccgggtggag
atggccatcttcttcatcgtctacatcattctcattgccttctttatgatgaacatcttc
gtgggctttgtcattgtcaccttccaggagcagggcgagaccgagtacaagaactgcgag
ctggacaagaaccagcgccagtgtgtgcagtacgccctgaaggcccgcccactgaagtgc
tacatccccaagaacccctaccagtaccaggtgtggtacgtggtcacctcctcctacttt
gagtatctgatgtttgccctcatcatgctcaacaccatctgcctgggcatgcagcactac
aaccagtcagagcagatgaaccaaatctccgacatcctcaacgtggccttcaccatcatt
ttcaccctggagatgatcctcaagctcatggcattcaaggccaggggctattttggagac
ccctggaatgtgtttgacttcctgatcgtcattggcagcatcatcgatgtcatcctcagc
gagattgatactttcctggcctccagcgggggactgtattgcctgggtggaggctgcggg
accgtagacccagacgagagcgcgcgcatttccagcgccttcttccgcctgttccgggtc
atgaggctgatcaagctgctgagccgggcggagggagtgcggaccctgctgtggacgttc
atcaagtccttccaggccctcccctacgtggccctgctcatcgtgatgctgttcttcatc
tacgcggtcatcggcatgcagatgttcgggaaaatcgccctggtggacggaacccaaata
aaccggaacaacaacttccagaccttcccgcaggccgtgctgctgctcttcaggtgtgcg
acgggtgaggcgtggcaggaggtgctgctggccagcagctacggcaagctgtgcgaccca
gagtccgagtacgcgccaggcgaggagtactcgtgcggcaccaacttcgcgtattactac
ttcatcagcttctacatgctctgcgccttcctgatcatcaacctcttcgtggctgtcatc
atggacaatttcgactacctcacacgagactggtccatcctgggccctcaccacctggac
gagttcaaggccatctgggcggagtatgacccggaggctacgggccgaatcaaacacctg
gacgtggtgaccctgctgaggaggatccagcccccactgggtttcgggaagttctgcccc
caccgggtggcatgcaagcggctcgtgggcatgaacatgcccctgaacagcgacggcacc
gtcaccttcaacgccaccctcttcgccctggtccgcacggccctcaagatcaagacagaa
ggtaactttgagcaggccaatgaggaactgagggccatcatcaagaagatctggaagaga
accagcatgaagctcctggaccaggtcatccctccgatcggagatgacgaggtgaccgtg
ggcaagttctacgccacgttcctcatccaggagcatttccgcaagttcatgaagcgccag
gaggagtattacgggtatcggcctaagaaggacgccgtgcagatccaggccggactgcgg
accattgaggaggaggcggcgcctgagatccgccggaccatctcgggagacctgacagcc
gaggaggagctggagagggccatggtggaggcagcgatggaggaagggatattccggaga
actggaggcctgtttggccaaatggacaacttcctggatagggccaactccctggccccc
gtcatggccaaccagaggcccctccagttttccgagatagagatggaagagctggagtcg
cccgtcttcttggaggacttccctcaagatccgggcaccaatccccttgctcgtgccaat
accaacaatgccaatgccaatgttgccgccggcaacagcaaccatagcaacagccaggtg
tttcccagtgcccgctatgaacaggagtcccctggagagacagagccgcctacagccaga
ggaggagtcctgggtcagtctcttctgtccctcctgccctcgccctatccacccacagga
ccccgcagccaatcctgtgtggaaaagcaggaaagccagctgactcagagagcggtgccc
agagcccaggcctctcctgccccctgccagtactccagggcggagagccccatgcctgaa
gcgagaagaagccccatgccagggcctctgccccaggaagccccccacagccgcaggacc
cccgagagcccttccagatgcctggctccagccactgccctgttgatacaggaggctcta
cttcgagggggcttggacaccttggcagccgatgctggcttcatcacagcgacaggccag
gccctggcagaggcctgccagatggaaccagaggacgtggaggtggcagccacagagcta
ctgagaagacgagagtcccccgagggcacagccggtgccctggggcccccgagcctcagg
tcctccctgggcagccttgacacgtgtcaaggctctcaggagaccctcattccccccagg
ccatga

KEGG   Miniopterus natalensis: 107537293
Entry
107537293         CDS       T05883                                 

Gene name
CACNB2
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit beta-2 isoform X1
  KO
K04863  voltage-dependent calcium channel beta-2
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna04921  Oxytocin signaling pathway
mna05410  Hypertrophic cardiomyopathy
mna05412  Arrhythmogenic right ventricular cardiomyopathy
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107537293 (CACNB2)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107537293 (CACNB2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107537293 (CACNB2)
   04261 Adrenergic signaling in cardiomyocytes
    107537293 (CACNB2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107537293 (CACNB2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107537293 (CACNB2)
   05414 Dilated cardiomyopathy
    107537293 (CACNB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107537293 (CACNB2)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107537293 (CACNB2)
SSDB
Motif
Pfam: Guanylate_kin VGCC_beta4Aa_N SH3_1 SH3_2
Other DBs
NCBI-GeneID: 107537293
NCBI-ProteinID: XP_016068762
LinkDB
Position
Unknown
AA seq 638 aa
MDLLESAASAGAQGAAAQSYGKGARRKNRFKGSDGSTSSDTTSNSFVRQGSADSYTSRPS
DSDVSLEEDREAVRREAERQAQAQLEKAKTKPVAFAVRTNVSYSAAHEDDVPVPGMAISF
EAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLENMRLQHEQRAKQGKFYSSKSGG
NSSSSLGDIVPSSRKSTPPSSAIDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKR
MPFFKKTEHTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRISITRVT
ADISLAKRSVLNNPSKHAIIERSNTRSSLAEVQSEIERIFELARTLQLVVLDADTINHPA
QLSKTSLAPIIVYVKISSPKVLQRLIKSRGKSQAKHLNVQMVAADKLSQCPPELFDVILD
ENQLEDACEHLADYLEAYWKATHPPSSTLPNPLLSRTLATSALPVSPTPASNSQGSQGDQ
RTDRSALARSASQAEEEPCLEPVKKSQHRVSSSAQHHNHRSGTNRGLSRQETFDSETQES
RDSAYVEPKEDYTHEHVDHYAPYRDHNHREEPHGSSEHRHRESRHRSRDLDREQDHNESN
KQRSRHKSKDRYCDKDGEGISKKRNEAGEWNRDVYIRQ
NT seq 1917 nt   +upstreamnt  +downstreamnt
atggacctgctggagagcgcggcgtccgcgggggcgcagggagcggccgcacagtcatat
ggaaaaggagctagaaggaaaaacagatttaaaggatccgatgggagcacgtcatctgac
actacctcaaatagttttgttcgtcagggttcggcagactcctacaccagccgtccatct
gattcagatgtgtctttggaggaagatcgggaggcagtgcgcagagaagcagagcgacag
gcccaggcccagttggaaaaagcaaagacaaagcctgttgcatttgcagttcggacaaat
gtcagctatagtgcagcccatgaagatgacgttccggtgcccggcatggccatctcattt
gaagcaaaagattttctgcatgttaaggaaaaatttaacaatgactggtggatagggcgg
ctggttaaagaaggctgtgaaatcggattcattccaagcccggtgaaactagagaatatg
cgcctgcagcatgaacagagagccaagcaagggaaattctactccagtaaatcaggagga
aattcatcatccagtttgggtgacatagtacctagttccagaaaatctacacctccatca
tctgctatagacatagatgctactggcttagatgcagaagaaaatgatattccagcaaac
caccgctcccctaagcccagtgcaaacagtgtaacgtcaccccactccaaagagaaaaga
atgcccttctttaagaagacagagcacacgcctccctatgatgtggtcccttccatgcgc
cctgtggtcttggtgggcccctctctgaaggggtacgaggtcacagatatgatgcaaaaa
gcgttgtttgattttttaaaacacagatttgaagggcggatatccatcacaagggtcacc
gccgacatctcgctggccaaacgctccgtgttaaacaaccccagcaagcacgcgatcata
gaaaggtccaacacaaggtccagcctagcggaagttcagagtgaaatagaaaggattttt
gaacttgcaagaacattgcaactggtagtccttgatgcggacactattaatcatccagct
caactcagtaaaacctctttggcccctattatagtttatgtaaagatttcttctcctaag
gttttacaaaggttaataaaatctcgagggaaatctcaagctaaacacctcaatgtccag
atggtagcagcagataaactgtcccagtgtcctccagagttgtttgatgtgatcttggat
gagaaccagctcgaggatgcttgtgagcaccttgctgactatctggaggcctactggaag
gccacccatccccccagcagcactctccccaaccctctccttagccgtactttagccact
tcagcgctgcctgttagccccactccagcctctaattcacagggttctcaaggtgatcag
aggactgatcgctctgctcttgcccgttcggcgtcccaagctgaagaagaaccctgcctg
gaaccagtcaagaaatcccagcaccgggtttcctcctcagcccagcaccacaaccatcgc
agtggtacaaatcgaggcctctccaggcaagagacatttgactcagaaacccaagagagt
cgagactctgcctacgtggagccaaaggaagattacacccacgaacatgtggaccactat
gccccataccgtgaccacaaccacagggaggagccccacgggagcagtgagcacagacac
agggagtctcggcaccgttccagggacctggatcgagagcaggaccacaatgaatccaac
aaacaacgaagccgtcataaatccaaggatcgctactgtgacaaggatggagaaggaata
tccaaaaaaaggaatgaggctggggagtggaacagggatgtttacatccgccaataa

KEGG   Miniopterus natalensis: 107538307
Entry
107538307         CDS       T05883                                 

Gene name
CACNG5
Definition
(RefSeq) voltage-dependent calcium channel gamma-5 subunit
  KO
K04870  voltage-dependent calcium channel gamma-5
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna04921  Oxytocin signaling pathway
mna05410  Hypertrophic cardiomyopathy
mna05412  Arrhythmogenic right ventricular cardiomyopathy
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107538307 (CACNG5)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107538307 (CACNG5)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107538307 (CACNG5)
   04261 Adrenergic signaling in cardiomyocytes
    107538307 (CACNG5)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107538307 (CACNG5)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107538307 (CACNG5)
   05414 Dilated cardiomyopathy
    107538307 (CACNG5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107538307 (CACNG5)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107538307 (CACNG5)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 COPI_assoc DUF716 DHHC Serinc
Other DBs
NCBI-GeneID: 107538307
NCBI-ProteinID: XP_016070008
LinkDB
Position
Unknown
AA seq 275 aa
MSACGRKALTLLSSVFAVCGLGLLGIAVSTDYWLYLEEGVILPQNQSTEIKMSLHSGLWR
VCFLAGEERGRCFTIEYVMPMNTQLTSESTVNVLKMIRSATPFPLVSLFFMFIGFILSNI
GHIRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEMLNRTKDAETYFSYKYGWSFA
FAAISFLLTESAGVMSVYLFMKRYTAEDMYRPHPGFYRPRLSNCSDYSGQFLHPDAWVRG
RSPSDISSDASLQMNSNYPALLKCPDYDQMSSSPC
NT seq 828 nt   +upstreamnt  +downstreamnt
atgagcgcctgcgggaggaaggcgctgaccctgctgagcagcgtctttgccgtctgcggc
ctgggcctcctgggcatcgccgtcagcaccgactactggctgtacctggaggagggcgtg
atcctgccccagaaccagagcacggagatcaagatgtccctgcactcgggcctatggcgt
gtgtgcttcctcgctggtgaggagcgtggacgctgcttcaccatagagtatgtgatgccc
atgaacacccagctgacgtccgagtccacggtcaacgttctgaaaatgatccgctcggcc
acgccattcccgctggtcagtctcttcttcatgttcattgggtttatcctgagcaacatc
ggacacatccgtccccacaggaccatactggcctttgtctccggcatcttcttcatcctt
tcaggcctctctcttgtggtgggcctggtgctctacatctccagcatcaatgacgagatg
ctcaacaggaccaaggacgcagagacctatttcagctacaagtacggctggtcgtttgcc
ttcgctgccatctccttccttttaacagagagtgcgggggtgatgtccgtgtacctgttc
atgaagaggtacaccgccgaggacatgtaccggccccaccccggcttctaccgcccacgg
ctgagcaactgctccgattactccggccagttcctgcaccccgacgcctgggtgcggggc
cgcagcccctccgacatctccagcgatgcctccctgcagatgaacagcaactacccagcc
ttgctcaagtgccccgactacgaccagatgtcatcctccccctgctga

KEGG   Miniopterus natalensis: 107540175
Entry
107540175         CDS       T05883                                 

Gene name
CACNA2D2
Definition
(RefSeq) voltage-dependent calcium channel subunit alpha-2/delta-2
  KO
K04859  voltage-dependent calcium channel alpha-2/delta-2
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna04921  Oxytocin signaling pathway
mna05410  Hypertrophic cardiomyopathy
mna05412  Arrhythmogenic right ventricular cardiomyopathy
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107540175 (CACNA2D2)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107540175 (CACNA2D2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107540175 (CACNA2D2)
   04261 Adrenergic signaling in cardiomyocytes
    107540175 (CACNA2D2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107540175 (CACNA2D2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107540175 (CACNA2D2)
   05414 Dilated cardiomyopathy
    107540175 (CACNA2D2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107540175 (CACNA2D2)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107540175 (CACNA2D2)
SSDB
Motif
Pfam: VGCC_alpha2 VWA_N VWA VWA_3 VWA_2 dCache_1 dCache_2 VWA_CoxE Ntox50
Other DBs
NCBI-GeneID: 107540175
NCBI-ProteinID: XP_016072356
LinkDB
Position
Unknown
AA seq 1146 aa
MCAGNSDKKFEREDKILEGVQSPQIQSSSSSKGWLLTRKIVFPQVPIAAGLPPTRRALLT
SLLSARRVQHWARRLEQEIDGVMRIFGGVQQLREIYKDNRNLFEVQENEPQKLVEKVAGD
IESLLDRKVQALKRLADAAETFQKAHRWQDNIKVRPTVPSSALSTCPPLARVDVSGGRLP
RPTEEDLPKQQPIFQEPSGWDQGPASLPLVELGQSSDTKGCPHHLDPGPPLPAGLSVPTP
ALPALTLPWGGPFLQDDPEVEGVERGSKVSTLKLDFVEDPNFKNKVNYSHTAVQIPTDIY
KGSTVILNELNWTEALENVFTENRRQDPTLLWQVFGSATGVTRYYPATPWRAPKKIDLYD
VRRRPWYIQGASSPKDMVIIVDVSGSVSGLTLKLMKTSVCEMLDTLSDDDYVNVASFNEK
AQPVSCFTHLVQANVRNKKVFKDAVQGMVAKGTTGYKAGFEYAFDQLQNSNITRANCNKV
IMMFTDGGEDRVQDVFEKYNWPNRTVRVFTFSVGQHNYDVTPLQWMACANKGYYFEIPSI
GAIRINTQEYLDVLGRPMVLAGKEAKQVQWTNVYEDALGLGLVVTGTLPVFNLTQDGPGE
KKNQLILGVMGIDVALNDIKRLTPNYTLGANGYVFAIDLNGYVLLHPNLKPQTTNFREPV
TLDFLDAELEDGNKEEIRRSMIDGNRGHKQIRTLVKSLDERYIDEVMRNYTWVPIRSTNY
SLGLVLPPYSTFYLQANLSDQILQVKLPISKLKDFEFLLPSSFESEGHVFIAPREYCKDL
NASDNNTEFLKNFIELMEKVTPDSKQCNNFLLHNLILDTGITQQLVERVWRDQDLNTYSL
LAVFAATDGGITRVFPNKAAEDWTENPEPFNASFYRRSLDSRGYVFKPPQQDALLRPLEL
ENDTVGILVSTAVEFSLGGRTLRPAVVGVKLDLEAWAEKFKVLASNRTHQDQPQKQCGPS
THCEMDCEVNNEDLLCVLIDDGGFLVLSNQNHQWDQVGRFFSEVDANLMLALYNNSFYTR
KESFDYQAACAPQPPGNLGAAPRGVFVPTIADFLNLAWWTSAAAWSLFQQLLYGLIYHSW
FQADPAEAEGSPEARESSCVVKQTQYYFGAVNASYNAIIDCGNCSSRQCPPKCPSYPQVL
IVTIYH
NT seq 3441 nt   +upstreamnt  +downstreamnt
atgtgtgcaggcaactctgacaagaagtttgaaagagaagacaagatcctcgagggtgtc
cagagtccccagattcagagcagcagcagcagcaagggctggctcctcaccaggaaaata
gtcttcccgcaggttcctatagctgctgggctccctcccaccaggcgggcactcctgacc
tctctcctctctgcacgcagggtgcagcactgggcacggcgcctggagcaggagatcgac
ggcgtgatgaggatcttcgggggcgtgcagcagctccgggagatctacaaggacaaccgg
aatctgtttgaggtgcaggaaaacgagcctcagaagctggtggagaaggtggccggggat
atcgagagcctgctagacaggaaggtgcaggccctgaagagactggctgatgctgcagag
accttccagaaggcccaccgctggcaggacaacatcaaggtaagacctacagtgccctcc
tcagccctgagcacctgcccacccctggcaagagtggatgtgagtgggggcaggctgccc
aggcccactgaagaggacctccctaagcagcagcccatcttccaggagccctcgggctgg
gatcagggaccagcctcccttccactggtggagctgggacagagctcagacaccaaggga
tgcccccaccacctagaccccggccctcccctgcctgcaggcctctctgtccccactcca
gcattgccagccctgacgctgccatgggggggtccctttctgcaggacgaccctgaggtt
gagggtgtggaaagggggtccaaggtcagcactctgaagctggacttcgttgaggacccc
aacttcaagaacaaggtcaactactcgcacacagcagtgcagatccccacggatatctac
aaaggctccaccgtcatcctcaatgagctcaactggacagaggccctggagaacgtgttc
accgagaaccgcaggcaggaccccacgctgctctggcaggtcttcggcagcgccacaggc
gtcactcgctactacccagccaccccatggcgagcccccaagaaaatcgacctgtacgat
gtccgaaggagaccctggtatatccagggagcctcatcgcccaaggatatggtcatcatt
gtggatgtgagtggcagcgtgagtggcctgaccctgaagctgatgaagacgtccgtctgc
gagatgctggacacgctctctgacgacgactatgtgaacgtggcctcgttcaacgagaag
gcacagcctgtgtcgtgcttcacgcacctggtgcaggccaacgtgcggaacaagaaggtg
ttcaaggatgcggtgcagggcatggtggccaagggcaccacgggctacaaggccggcttt
gagtatgcctttgaccagctacagaactccaacatcacccgtgccaactgcaacaaggtg
atcatgatgttcacggatgggggcgaggaccgcgtgcaggacgtcttcgagaagtacaac
tggcccaaccgcacggtgcgagtgttcaccttctccgtggggcagcacaactatgatgtc
acacccctgcagtggatggcctgcgccaacaaaggttactattttgagatcccttccatc
ggagccatccgcatcaacacgcaggaatatctggacgtcttgggcaggcccatggtcctg
gcgggcaaggaggccaagcaggtgcaatggaccaacgtgtatgaggatgcgctggggctg
gggctggtggtgacagggaccctcccagtattcaacctgacgcaggatggccctggggaa
aaaaagaaccagctgatcctgggcgtgatgggtatcgacgtggctctgaatgacatcaaa
aggctgactcccaactacacgcttggagccaacggctacgtctttgccattgacttgaac
ggctatgtgctgctgcaccccaacctcaagccccagaccaccaacttccgggagcctgtg
accctggacttcctggacgccgagctggaagacggaaacaaggaggagatccgtcggagc
atgatcgatggcaacaggggccacaagcagatcagaacgttggtcaagtccctggacgag
aggtacatagatgaggtgatgcggaactacacctgggtgcccataaggagcaccaactac
agcctggggctcgtgctgcccccctacagcaccttctacctccaagccaacctcagcgac
cagatcctgcaggtcaagttgccaatcagcaaactgaaggattttgagttcctgctcccc
agcagctttgagtctgaaggacatgttttcattgctcccagagagtattgcaaggacctg
aatgcctcagacaacaacaccgagttcctgaaaaacttcattgagctcatggagaaagtg
actccggactccaagcagtgcaacaacttccttctgcacaacctgatcttggacacaggc
atcacacaacagctggtggagcgtgtgtggcgggaccaggatctcaacacgtatagcctt
ctggctgtgtttgctgccactgacggcggcatcactcgagtattccccaacaaggcagct
gaggactggacggagaaccctgagcccttcaatgccagtttctaccgccgcagcctggat
agccgtggctatgtcttcaagcccccacagcaggacgccctgttaaggcctctggagctg
gagaacgacacggtgggcatccttgtcagcacagctgtggagttcagcctgggtggacgc
accctgaggccagcagtggtgggtgttaagctggatctagaggcctgggctgagaagttc
aaggtgctagccagcaatcgtacccaccaggaccagcctcagaagcagtgcggccccagc
acccactgtgagatggactgcgaggtaaacaatgaggacctgctctgtgtcctcattgat
gacgggggattcctggtgctgtcaaaccagaaccatcagtgggaccaggtgggcaggttc
ttcagtgaggtggatgccaacctgatgctggcgctctacaataactccttctacacccgc
aaggagtccttcgactatcaggcagcctgtgccccacaacccccaggcaacctgggtgct
gcaccccggggtgtctttgtgcccaccattgcagacttccttaacctggcctggtggacc
tcagctgccgcctggtccttgttccagcagctcctctatggcctcatctaccacagctgg
ttccaggcagatcccgcggaggccgagggcagccccgaggcgcgcgagagcagctgcgtc
gtgaagcagacccagtactacttcggggcggtgaacgcctcctacaacgccatcatcgac
tgcggcaactgctccagccgccagtgtccccctaaatgcccctcatacccccaggtgctc
attgtaaccatttatcactag

KEGG   Miniopterus natalensis: 107540425
Entry
107540425         CDS       T05883                                 

Gene name
CACNG6
Definition
(RefSeq) voltage-dependent calcium channel gamma-6 subunit
  KO
K04871  voltage-dependent calcium channel gamma-6
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna04921  Oxytocin signaling pathway
mna05410  Hypertrophic cardiomyopathy
mna05412  Arrhythmogenic right ventricular cardiomyopathy
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107540425 (CACNG6)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107540425 (CACNG6)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107540425 (CACNG6)
   04261 Adrenergic signaling in cardiomyocytes
    107540425 (CACNG6)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107540425 (CACNG6)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107540425 (CACNG6)
   05414 Dilated cardiomyopathy
    107540425 (CACNG6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107540425 (CACNG6)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107540425 (CACNG6)
SSDB
Motif
Pfam: Claudin_2 PMP22_Claudin
Other DBs
NCBI-GeneID: 107540425
NCBI-ProteinID: XP_016072667
LinkDB
Position
Unknown
AA seq 244 aa
MRGPGPRFLQEAPVSCPLQGLKRGVCVKINHFPEDTDYDHDSAEYLLRVVRASSIFPILS
AILLLLGGVCVAASRVYKSKRNIILGAGILFVAAEANCTYFKFFTTGENAHIFQRTTKKE
LNLAAAVIAVLGLTVMALGCLCIIMVLSKGAEFLVRVGAVCFGLSGLLLLVSVEVFRHSV
RALLQTASPEPPPAPALTYEYSWSLGCCVGASLVLLLVGSCFLLLTLPPWPWGSLCPKQG
HRAP
NT seq 735 nt   +upstreamnt  +downstreamnt
atgcgcgggcccgggccccgcttcctccaggaggcgcccgtgagctgccccttgcagggg
ctgaaaagaggcgtctgcgtgaagatcaaccattttccggaggacactgactacgaccat
gacagcgcggagtatctgctccgagtagtccgggcctccagcatcttccccatcctcagc
gccatcctgctgctgctggggggcgtgtgcgtggcggcctcccgggtctacaagtccaag
aggaacatcattctgggcgcaggaatcctgttcgtggcagcagaagccaactgcacctat
tttaaattcttcaccacgggggagaatgcgcacatcttccagagaaccacaaagaaagag
ctgaatctggcggctgcggtgatagcggtgctgggcctgacggtcatggccctggggtgc
ctctgcatcatcatggtgctcagcaagggcgccgagttcctggtccgagttggagcggtc
tgcttcggcctctcgggcctgctgctcctggtcagcgtggaggtgttccggcactccgtg
cgagccctgctgcagacggccagccccgagccccccccggcgcccgccctgacctatgag
tactcctggtcgctgggctgctgcgtgggtgccagcctggtcctgctgctggtgggcagc
tgcttcctcctgctcacgctgccgccctggccctggggctcactctgtcccaagcagggc
cacagggccccctag

KEGG   Miniopterus natalensis: 107540464
Entry
107540464         CDS       T05883                                 

Gene name
CACNG7
Definition
(RefSeq) voltage-dependent calcium channel gamma-7 subunit
  KO
K04872  voltage-dependent calcium channel gamma-7
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna04921  Oxytocin signaling pathway
mna05410  Hypertrophic cardiomyopathy
mna05412  Arrhythmogenic right ventricular cardiomyopathy
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107540464 (CACNG7)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107540464 (CACNG7)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107540464 (CACNG7)
   04261 Adrenergic signaling in cardiomyocytes
    107540464 (CACNG7)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107540464 (CACNG7)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107540464 (CACNG7)
   05414 Dilated cardiomyopathy
    107540464 (CACNG7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107540464 (CACNG7)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107540464 (CACNG7)
SSDB
Motif
Pfam: Claudin_2 PMP22_Claudin DUF716 Claudin_3 Amastin L_HMGIC_fpl Serinc DUF4064
Other DBs
NCBI-GeneID: 107540464
NCBI-ProteinID: XP_016072724
LinkDB
Position
Unknown
AA seq 275 aa
MSHCSSRALTLLSSVFGACGLLLVGIAVSTDYWLYMEEGTVLPQNQTTEVKMALHAGLWR
VCFFAGREKGRCVASEYFLEPEINLVTENTENILKTVRTATPFPMVSLFLVFTAFVISNI
GHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRPSSSEQYFHYRYGWSFA
FAASSFLLKEGAGVMSVYLFTKRYAEEEMYRPHPAFYRPRLSDCSDYSGQFLQPEAWRRG
RSPSDISSDVSIQMTQNYPPAIKYPDHLHISTSPC
NT seq 828 nt   +upstreamnt  +downstreamnt
atgagtcactgcagcagccgcgccctgaccctgctgagcagcgtgttcggggcgtgtggc
ctgctgctcgtgggcatcgcggtgagcactgactactggctgtacatggaggaggggacg
gtgctgccgcagaaccagaccacggaggtcaagatggccctgcacgccggcctctggcgc
gtctgcttcttcgcaggtcgggagaagggtcgctgcgtggcctccgagtatttccttgaa
ccggagatcaacttggtgacggaaaacacggagaacattctgaagacagtgcgcacagcc
acccccttccccatggtcagcctcttcctcgtgttcaccgccttcgtcatcagcaacatc
ggccacatccgcccccagaggaccattctggccttcgtttctggaatcttcttcatccta
tcaggcctctccttggtggtgggcttggttctctacatttccagcatcaacgacgaggtc
atgaacaggcccagcagctccgagcagtatttccactatcgctacgggtggtcgtttgcc
ttcgccgcttcctcctttctgctcaaagagggggctggcgtgatgtccgtgtatttgttc
accaagcgctacgcggaggaggagatgtaccggccgcaccccgccttctaccgcccgcgc
ctcagcgactgctccgactactcgggccagttcctgcagcccgaggcctggcgccgcggc
cgcagcccctcggacatctccagcgacgtgtccatccagatgacgcagaactaccccccc
gccatcaagtaccccgaccacctgcacatctccacctcgccctgctga

KEGG   Miniopterus natalensis: 107541372
Entry
107541372         CDS       T05883                                 

Gene name
CACNA1F
Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent L-type calcium channel subunit alpha-1F
  KO
K04853  voltage-dependent calcium channel L type alpha-1F
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04020  Calcium signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna04270  Vascular smooth muscle contraction
mna04723  Retrograde endocannabinoid signaling
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna04911  Insulin secretion
mna04912  GnRH signaling pathway
mna04921  Oxytocin signaling pathway
mna04924  Renin secretion
mna04925  Aldosterone synthesis and secretion
mna04927  Cortisol synthesis and secretion
mna04929  GnRH secretion
mna04934  Cushing syndrome
mna04935  Growth hormone synthesis, secretion and action
mna05010  Alzheimer disease
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05410  Hypertrophic cardiomyopathy
mna05412  Arrhythmogenic right ventricular cardiomyopathy
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107541372 (CACNA1F)
   04020 Calcium signaling pathway
    107541372 (CACNA1F)
   04024 cAMP signaling pathway
    107541372 (CACNA1F)
   04022 cGMP-PKG signaling pathway
    107541372 (CACNA1F)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107541372 (CACNA1F)
   04929 GnRH secretion
    107541372 (CACNA1F)
   04912 GnRH signaling pathway
    107541372 (CACNA1F)
   04921 Oxytocin signaling pathway
    107541372 (CACNA1F)
   04935 Growth hormone synthesis, secretion and action
    107541372 (CACNA1F)
   04924 Renin secretion
    107541372 (CACNA1F)
   04925 Aldosterone synthesis and secretion
    107541372 (CACNA1F)
   04927 Cortisol synthesis and secretion
    107541372 (CACNA1F)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107541372 (CACNA1F)
   04261 Adrenergic signaling in cardiomyocytes
    107541372 (CACNA1F)
   04270 Vascular smooth muscle contraction
    107541372 (CACNA1F)
  09156 Nervous system
   04727 GABAergic synapse
    107541372 (CACNA1F)
   04725 Cholinergic synapse
    107541372 (CACNA1F)
   04726 Serotonergic synapse
    107541372 (CACNA1F)
   04723 Retrograde endocannabinoid signaling
    107541372 (CACNA1F)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107541372 (CACNA1F)
   05020 Prion disease
    107541372 (CACNA1F)
   05022 Pathways of neurodegeneration - multiple diseases
    107541372 (CACNA1F)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107541372 (CACNA1F)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107541372 (CACNA1F)
   05414 Dilated cardiomyopathy
    107541372 (CACNA1F)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107541372 (CACNA1F)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107541372 (CACNA1F)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107541372 (CACNA1F)
SSDB
Motif
Pfam: Ion_trans CAC1F_C Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 107541372
NCBI-ProteinID: XP_016073872
LinkDB
Position
Unknown
AA seq 1910 aa
MSASEGRKGESSLPPLQTLXASLGSWQPFDILILLTIFANCVALGVYIPFPEDDSNTANH
NLEQVEYVFLVIFTVETVLKIVAYGLVLHPSAYIRNGWNLLDFIIVVVGLFSVLLEQGPG
RPGDAPHTGGKPGGFDVKALRAFRVLRPLRLVSGVPSLHIVLNSIMKALVPLLHIALLVL
FVIIIYAIIGLELFLGRMHKTCYFLGSDLEAEEDPSPCASSGSGRACTLNQTECRGRWAG
PNGGITNFDNFFFAMLTVFQCVTMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLN
LVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLRGYLDWITQAEELDSEDPSADGNF
GSVAEEGRAGHRPQLAELTNRRRGRLRWFSHSTRSTHSTNSHASLPASDTGSMAETPGDE
EEEEGALASCTRCLNKIMKTRVCHSLRRANRGLRACCRQAVKSNACYWAVLLLVFLNTLT
IASEHHGQPIWLTQTQEYANKVLLCLFTVEMLLKLYGLGPSTYVSSFFNRFDCFVVCGGI
LETTLVEVGAMQSLGISVLRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASLLLLLFL
FIIIFSLLGMQLFGGKFNFDQTHTKRSTFDTFPQALLTVFQILTGEDWNVVMYDGIMAYG
GPFFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLASGDAGTAKNKGREKSTEGKPPQE
NGALVPGGENEEEEGAKNAGAGMEEEEEEEEEEEEEGAGRVELLQEVVPKEKVVPIPEGS
AFFCLSQTNRMRTACHTLIHHHVFTNLILVFIILSSVSLAAEDPIRAHSFRNHILGYFDY
AFTSIFTVEILLKMTVFGAFLHRGSFCRSWFNLLDLLVVSVSLISFGIHSSAISVVKILR
VLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYSC
TDEAKHTPQECKGSFLIYPDGDVSRPLVRERLWVNSDFNFDNVLSAMMALFTVSTFEGWP
ALLYKAIDAHAEDQGPIYNYHVEISVFFIVYIIIIAFFMMNIFVGFVIITFRAQGEQEYQ
NCELDKNQRQCVEYALKAQPLRRYIPKNPHQYRVWATVNSAAFEYLMFLLILLNTVALAM
QHYEQTAPFNYAMDILNMVFTGLFTVEMVLKIIAFKPKHYFADAWNTFDALIVVGSIVDI
AVTEVNNGGHLGESSEDSSRISITFFRLFRVMRLVKLLSKGEGIRTLLWTFIKSFQALPY
VALLIAMIFFIYAVIGMQMFGKVALQDGTQINRNNNFQTFPQAVLLLFRCATGEAWQEIM
LATLPGNRCDPESDFGPGEEFTCGSNFAIAYFISFFMLCAFLIINLFVAVIMDNFDYLTR
DWSILGPHHLDEFKRIWSEYDPGAKGRIKHLDVVALLRRIQPPLGFGKLCPHRVACKRLV
AMNMPLNSDGTVTFNATLFALVRTSLKIKTEGGNLEQANQELRIVIKKIWKRLKQKLLDE
VIPPADEDEVTVGKFYATFLIQDYFRKFRRRKEKGLLGTEAPPSTSSVLQAGLRSLQDLI
PEIRQALSCDTEEEEEEGQEREEKEDEKDPETYQALMGSQPPSRRSSISVSLPTGDKLPD
SLSSGPSDDNVGAPNSRQSSVPQAGSHARRRSSGALIFTIPEEGSFQPRGTEGQAKQYEE
EEVLGQLSLDEPAGTPPRPILLPPHRPQRYLDGHHAPCRRLLPPTPTPAGQKPSFTIQCL
RRQGSCEDLPIPGTYHRGHNSGPSKAQGSWATPPQRGRLLYAPLLLVEEGAPGMHSLSKS
SGGPLFTFTCLQVPGTHSDHSHGKRGSADSLVEAVLFSEGLDIFARDPRFVALAKQEIAD
ACRLTLDEMDSAASDLLAQGTSSLYSDEESILSRFDEEDLGDEMACVHAL
NT seq 5733 nt   +upstreamnt  +downstreamnt
atgtcggcatctgaaggcaggaaaggtgagagcagccttccacccctgcagaccctttga
gcaagcctgggctcttggcagcccttcgacatcctcatcctgctgaccatctttgccaac
tgcgtggccctgggggtctacattcccttcccagaagacgactccaacactgccaaccac
aacctggaacaggtggagtacgtatttctggtgattttcactgtggagacggtgctcaag
atcgtggcctacgggctggtgctccatcctagcgcctacatccgcaatggctggaaccta
ctcgacttcatcatcgttgtggtcgggttgttcagcgtactactggaacagggccccgga
cggcctggggacgctccgcacactggggggaagccagggggctttgatgtgaaggctttg
cgggcatttcgggtgttgcggccactgaggctggtgtctggggtcccgagcctgcacata
gtgctcaattccatcatgaaggcgctggtgccgctgctgcacatcgccctactcgtgctc
ttcgtcatcattatttatgccatcatcggactcgagctgttcctcggacgcatgcacaaa
acgtgctacttcctgggatcggacttggaagccgaggaggacccatcgccctgtgcatct
tctggctccgggcgtgcgtgcaccctgaaccagaccgagtgccgcgggcgctgggcaggg
cccaatggaggcatcactaacttcgacaacttcttcttcgccatgctgacggtcttccaa
tgtgtcaccatggaaggctggaccgacgtgctctactggatgcaggatgccatggggtat
gagctgccctgggtgtatttcgtgagtctcgtcatctttgggtccttctttgtcctcaac
cttgtacttggcgtcctgagtggggagttctccaaggagagagagaaggcaaaagcacga
ggggacttccagaagctgcgggagaagcagcagttggaggaggacctgcggggctatctg
gactggatcacacaggcagaggagctggacagtgaagacccctcagctgatggcaacttt
ggttctgtggctgaagagggcagggctggccacaggccacaactggcagagctgaccaat
aggagacgtggacgtctgcgttggttcagtcactccacccgctccacacattccaccaac
agccatgccagcctgccagccagtgacaccggttcgatggcagagacgccaggagatgag
gaagaggaggagggggctctggcgagttgtacacgctgcctaaacaagatcatgaaaacc
agggtctgccacagcctccgtcgagccaaccggggccttcgggcatgctgccggcaagct
gtgaagtccaatgcgtgttactgggctgtgctgctgctcgttttcctcaacacactgact
atcgcttcagagcaccacgggcagcccatatggctcacccagacccaggaatatgccaac
aaagtgttgctctgtctgttcacggtggagatgcttctcaagttgtacggtctgggcccc
tccacctacgtttcctccttcttcaaccgttttgactgctttgtggtctgtgggggcatc
ctggaaaccacactggtggaggtgggcgccatgcagtccctggggatctcagtgctccga
tgtgtgcgtcttctcaggatctttaaggtcactaggcactgggcatctctgagcaatttg
gtggcatccctgctcaattcaatgaaatccatcgcgtccttgctgcttctcctcttcctc
tttatcatcatcttctccctgcttggcatgcagctgtttgggggcaagttcaactttgac
cagacccacaccaagcgaagcacctttgacactttcccccaggccctcctcactgtcttt
cagatcctgacaggtgaggactggaacgtggtaatgtatgatggtatcatggcttacggc
ggccccttcttcccagggatgctggtgtgcatctatttcatcattctcttcatctgcggc
aactacatcctgttgaatgtgtttcttgccattgctgtggacaacctagccagtggagat
gcaggcactgccaagaacaagggcagggagaagagcactgaagggaaacccccacaggaa
aatggagcattggtgcctggtggggagaatgaagaagaggagggtgcaaagaatgcagga
gcaggaatggaggaagaggaggaagaggaagaagaggaggaggaagagggtgcagggcgt
gtggaactcctacaggaagttgtacccaaggagaaggtggtgcccatccctgagggcagc
gccttcttctgcctcagccaaaccaaccgaatgaggacggcttgtcacaccctcatccac
catcacgtcttcaccaatcttatcctggtgttcatcattctcagcagtgtatccctagct
gctgaggaccccatccgagcgcactccttccgcaaccacattctggggtacttcgactat
gccttcacctccattttcactgtggagattctactaaagatgacggtgttcggggccttc
ctgcacagaggctccttctgccgtagttggttcaatctcttggatctgctggtagtcagt
gtgtctctcatctcttttggcatccactccagtgccatctcagtagtaaagattctgcga
gtactccgagttcttcggccccttcgagccatcaaccgggccaagggactcaagcacgtg
gtacagtgtgtgttcgtggccatccggaccatcgggaatatcatgattgtaaccacactc
ctgcaattcatgtttgcctgcattggtgtacagctcttcaaggggaaattctacagttgc
actgatgaggccaaacacacaccccaagaatgcaagggctccttcctgatttatcctgat
ggagatgtgtcacggcccctggtccgggagcggctctgggtcaacagcgatttcaacttt
gacaatgtcctttcagccatgatggctctgttcactgtctccacctttgaaggctggcct
gcgctgctatacaaggccattgatgcacatgcagaggaccagggccccatctataattac
cacgtggagatatcagtgttcttcattgtttatatcatcatcatcgcattcttcatgatg
aacatctttgtgggctttgtcatcatcaccttccgtgcccagggggagcaggaataccaa
aactgtgagctggacaagaaccagcgccagtgcgtggagtatgccctcaaggcccagcca
ctccgccgttacatccccaagaacccacaccagtatcgtgtatgggccactgtgaactct
gctgcctttgagtacctcatgttcctgctcatcctgctcaacactgttgctctagccatg
cagcactatgagcagactgctcccttcaactatgccatggacatcctcaatatggtcttc
actggcctctttactgttgagatggtgctcaaaatcatagccttcaaacctaagcattac
tttgctgatgcctggaacacatttgatgctcttattgtggtgggcagcatagtggacatt
gctgtcactgaagtcaacaatggtggccatcttggcgagagctctgaggacagttcccga
atttccatcaccttctttcgcctcttccgagtcatgcgactggtcaagcttctcagcaag
ggtgaagggatccgcacattactctggacattcatcaagtccttccaggccttgccctat
gttgctcttctcatcgcaatgatattcttcatttatgcagtcattgggatgcaaatgttt
ggcaaggtggctcttcaggatggcacacagatcaaccgaaacaacaactttcagactttt
ccacaggctgtgctgcttctgttcaggtgtgccactggtgaggcatggcaagagataatg
cttgccacccttcccgggaatcgatgtgaccctgagtctgacttcggccctggcgaggag
tttacctgtggtagcaattttgccatcgcctattttattagcttcttcatgctctgtgcc
ttcctgattataaatctctttgtggctgtgatcatggacaactttgattatttaaccaga
gattggtccatcctgggcccccatcacctcgatgaattcaagaggatctggtctgaatat
gaccctggggccaaaggccgcattaaacacctggatgtggttgccctgctgagacgtatc
cagccaccactgggatttgggaagctgtgcccacaccgagtggcctgcaagagacttgtg
gcgatgaacatgcccctcaactcagatgggacggtaacattcaacgccacactctttgcc
ctggttcggacatccctgaagatcaagacagaaggagggaacctggagcaagccaatcag
gagctgcggattgtcatcaaaaagatctggaagcggctgaagcagaagctgctagatgag
gtcatcccccctgccgatgaggacgaggtcaccgtgggcaaattctatgccacatttctg
atccaggactatttccgcaaattccggcggaggaaagaaaaggggcttctagggaccgag
gcccccccaagcacctcctctgtccttcaggctggtctgaggagcctacaggacttgatt
cctgagatccgacaggccctaagctgtgacacagaggaggaggaggaggaggggcaggag
agagaggagaaggaagatgagaaggacccagaaacataccaagccctgatgggatcccag
cccccatctcgtaggagctccatttctgtgtctctgcctactggggacaaacttccagat
tcactctcctctgggcccagtgatgacaatgtgggggctcccaactccagacagtccagt
gtgccccaggctggatcccatgcccgcaggagaagttctggggctctcattttcaccatt
ccggaagaaggaagttttcagcccaggggaactgaagggcaggccaaacagtatgaggaa
gaagaagtcctgggccagctctccttagatgagccggcagggactcccccacgccccatc
cttttgccacctcacagaccccagaggtacctggatgggcaccatgcaccatgccgccgt
ctgctgcccccaacaccaacacctgcaggtcagaagccctccttcaccatccagtgtttg
cggcgccagggaagttgtgaagatttacccatcccaggcacctatcatcgtgggcacaac
tcagggcccagcaaggcacagggttcctgggcaacccctcctcagcggggtcggctcctg
tacgccccgctgctattggtggaggagggtgcaccagggatgcactccctcagcaagtcc
agcggcggtccgcttttcacctttacctgtctgcaagtgcctggaacccactcggaccac
agccatggcaagaggggcagtgctgacagcctggtggaggctgtgctcttctctgagggc
cttgacatctttgcccgagatccgcgcttcgtggccctggccaagcaggagatcgcggat
gcgtgtcgcctgacactggacgagatggacagtgctgccagtgacctgctggcacaggga
accagctcactttatagtgacgaagaatccatcctctcccgctttgatgaagaagacctg
ggagatgagatggcctgtgtccatgccctctga

KEGG   Miniopterus natalensis: 107544760
Entry
107544760         CDS       T05883                                 

Gene name
CACNG3
Definition
(RefSeq) voltage-dependent calcium channel gamma-3 subunit
  KO
K04868  voltage-dependent calcium channel gamma-3
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna04921  Oxytocin signaling pathway
mna05410  Hypertrophic cardiomyopathy
mna05412  Arrhythmogenic right ventricular cardiomyopathy
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107544760 (CACNG3)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107544760 (CACNG3)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107544760 (CACNG3)
   04261 Adrenergic signaling in cardiomyocytes
    107544760 (CACNG3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107544760 (CACNG3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107544760 (CACNG3)
   05414 Dilated cardiomyopathy
    107544760 (CACNG3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107544760 (CACNG3)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107544760 (CACNG3)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 ABC2_membrane_2
Other DBs
NCBI-GeneID: 107544760
NCBI-ProteinID: XP_016078156
LinkDB
Position
Unknown
AA seq 315 aa
MRMCDRGIQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCRTKSTSDNETSRKNEEVMTH
SGLWRTCCLEGAFRGVCKKIDHFPDDADYEQDTAEYLLRAVRASSVFPILSVTLLFFGGL
CVAASEFHRSRHSVILSAGIFFVSAGLSNIIGIIVYISANAGDPGQRDSKKSYSYGWSFY
FGAFSFIIAEIVGVVAVHIYIEKHQQLRARSHSELLKKSTFARLPPYRYRFRRRSSSRST
EPRSRDLSPISKGFHAIPSTDISMFTLSRDPSKITMGTLLNSDRDHAFLQFHNSTPKDFQ
EALHNDLASRRTTPV
NT seq 948 nt   +upstreamnt  +downstreamnt
atgaggatgtgtgacagaggtatccagatgttgatcaccactgtgggagccttcgcagct
tttagcttaatgaccattgcagtgggcacggactactggttatattccaggggcgtgtgc
aggactaaatctacaagtgataatgaaaccagcaggaagaatgaagaggtaatgacacac
tcggggctgtggaggacctgctgcctggaaggcgctttccgaggagtctgcaagaaaatt
gaccacttcccagacgatgctgactacgaacaggacacagctgagtacctgctgcgggcg
gtgagggcctccagcgtcttccccatcctcagcgtcacgctgctcttcttcggcgggctc
tgcgtggcggccagcgagttccaccgcagcaggcacagcgtcatcctcagcgcgggcatc
ttcttcgtctctgcagggttaagcaacatcatcggcatcatagtttatatatcggccaac
gctggggaccccgggcagcgtgactccaaaaagagctactcgtatggctggtccttctac
ttcggagccttctccttcatcatcgccgagatcgtgggcgtggtcgccgtgcacatctac
atagagaagcaccagcagctgcgcgccaggtcccactcggagctcctgaagaagtccact
tttgctcgcctgccaccctacaggtacagattccggcggcggtccagctcccgctccacg
gagccccggtcccgggacctgtcccccatcagcaaaggcttccacgccatcccctccacc
gacatctcgatgttcaccctctcccgggacccctccaagatcaccatggggaccctcctc
aactccgaccgggaccacgcgttcctccagttccacaattccacgcccaaagacttccag
gaggcgctgcacaacgacctggccagcaggcgcaccacgcccgtctga

KEGG   Miniopterus natalensis: 107545336
Entry
107545336         CDS       T05883                                 

Gene name
CACNG2
Definition
(RefSeq) voltage-dependent calcium channel gamma-2 subunit
  KO
K04867  voltage-dependent calcium channel gamma-2
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna04921  Oxytocin signaling pathway
mna05410  Hypertrophic cardiomyopathy
mna05412  Arrhythmogenic right ventricular cardiomyopathy
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107545336 (CACNG2)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107545336 (CACNG2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107545336 (CACNG2)
   04261 Adrenergic signaling in cardiomyocytes
    107545336 (CACNG2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107545336 (CACNG2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107545336 (CACNG2)
   05414 Dilated cardiomyopathy
    107545336 (CACNG2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107545336 (CACNG2)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107545336 (CACNG2)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2
Other DBs
NCBI-GeneID: 107545336
NCBI-ProteinID: XP_016078908
LinkDB
Position
Unknown
AA seq 323 aa
MGLFDRGVQMLLTTVGAFAAFSLMTIAVGTDYWLYSRGVCKSKSVSENETSKKNEEVMTH
SGLWRTCCLEGNFKGLCKQIDHFPEDTDYEADTAEYFLRAVRASSIFPILSVILLFMGGL
CIAASEFYKTRHNIILSAGIFFVSAGLSNIIGIIVYISANAGDPSKSDSKKNSYSYGWSF
YFGALSFIIAEMVGVLAVHMFIDRHKQLRATARATDYLQASAITRIPSYRYRYQRRSRSS
SRSTEPSHSRDASPVGLKGFNTLPSTEISMYTLSRDPLKAATTPTATYNSDRDNSFLQVH
NCIQKENKDSLHSNTANRRTTPV
NT seq 972 nt   +upstreamnt  +downstreamnt
atggggctgtttgatcgaggtgttcaaatgcttttaaccaccgttggtgctttcgctgcc
ttcagtctgatgaccatagctgtgggaaccgactattggctctactccagaggggtttgc
aagagcaaaagtgtcagtgagaatgaaaccagcaaaaagaacgaggaagttatgacccat
tctggattatggagaacctgctgcttagaagggaacttcaaaggcctctgcaagcaaatt
gatcacttcccagaggatacagattacgaagctgacacagcagaatatttcctccgggct
gttagggcctcgagcattttcccgatcctgagtgtgattctgcttttcatggggggactc
tgcatcgcagccagcgagttctacaagactcgacacaacatcatcctgagtgccggcatc
ttctttgtgtctgcaggtctgagtaacatcattggcatcatagtgtacatatctgccaat
gccggagacccctccaagagcgactccaaaaagaatagttactcgtatggctggtccttc
tacttcggggccctgtccttcatcattgccgagatggtcggtgtgctggccgtgcacatg
tttatcgaccggcacaaacagctgcgggccacggcccgcgccacggactacctccaggcc
tccgccatcacccgcatccccagctaccgctaccgctaccagcgccgcagccgctccagc
tcccgctccaccgagccctcacactccagggacgcctcccccgtgggcctcaagggtttc
aacaccttgccgtccacggagatctccatgtacaccctcagcagggaccccctgaaggcc
gccaccacgcccaccgccacctacaactccgacagggataacagcttcctccaagttcac
aactgtatccagaaggagaacaaagactctctccactccaacacagccaaccgccggacc
acccccgtatga

KEGG   Miniopterus natalensis: 107546422
Entry
107546422         CDS       T05883                                 

Gene name
CACNA2D4
Definition
(RefSeq) voltage-dependent calcium channel subunit alpha-2/delta-4
  KO
K04861  voltage-dependent calcium channel alpha-2/delta-4
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna04921  Oxytocin signaling pathway
mna05410  Hypertrophic cardiomyopathy
mna05412  Arrhythmogenic right ventricular cardiomyopathy
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107546422 (CACNA2D4)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107546422 (CACNA2D4)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107546422 (CACNA2D4)
   04261 Adrenergic signaling in cardiomyocytes
    107546422 (CACNA2D4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107546422 (CACNA2D4)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107546422 (CACNA2D4)
   05414 Dilated cardiomyopathy
    107546422 (CACNA2D4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107546422 (CACNA2D4)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107546422 (CACNA2D4)
SSDB
Motif
Pfam: VWA_N VGCC_alpha2 VWA_3 VWA VWA_2 DUF2201 CobT_C VWA_CoxE
Other DBs
NCBI-GeneID: 107546422
NCBI-ProteinID: XP_016080291
LinkDB
Position
Unknown
AA seq 909 aa
MPCCLRPSLRKTAVILCLLLSSTYLSPAWGQAKIPLETVKLWADTFGGDLYDTVTKYSGS
LLLQKKYKDVEPSLRIQEVDGLELVRKFSEDMETMLRRKVEAVKNLVEAAEEADLNHEFN
ESLVFDYYNAALVNERDASGEHVELGAEFVLEPNAHFSNLMVNTSLSSVQLPTNVYNKDP
DILNGVYMSEALNPVFVENFQRDPTLTWQYFGSSTGFFRIYPGIKWTPDENGVITFDCRN
RGWYIQAATSPKDVVIVVDTSGSMKGLRMAIAKHTIATILDTLGENDFVNIIAYNDYVHY
LEPCFKGILVQADRDNREHFKHLVNELMVKGVGAVGQALREAFHILKQFQEARQGSLCNQ
AIMLITDGAMEDYKPVFEKYNWPDRKVRVFTYLIGREVTFADHLKWIACNNKGYYTQIST
LADAQENVMEYLHVLSRPMVINHDHDIIWTEAYMDSKLVTAQAQSMMLLTTVAMPVFSKK
NETLGVHGYAFLNTNNGYILSHPDLRPLYKEGKKLKPKPNYNSVDLSEVEWEDRAEILRT
AMINGETGSLSMDVKVPLDKGKRVLFLTNDYFFTGISDTPFSLGVVLSQGHGEYLLLGNT
SVEEGLHDLLHPDLTLASDWIYCITDIDPDHRKLSQLEAMVRFLTGEDPDLECDKELVQE
VLFDAVVTAPMEAYWTALALNISEESERVADMAFLGTRAGLLRSSLFVGSEKLSDKKFLT
AEDKASVFTMDHFPLWYRQAAEQPAGSFVFNLGSAEGPEGPDEPVVVTASTAVAVTVDKK
TAIAAAVGIQLRLDFLQRRFWAAVRQCSAGDGPCPKSCRESDLDCFIIDNNGFILISERS
REMGRFLGEVDGALMTQLLSTGAFSQVTMYDYQAMCKPPSHHHSAARPLVSPISALLTAT
RWLVNELLL
NT seq 2730 nt   +upstreamnt  +downstreamnt
atgccctgctgcctgaggccctccctgcggaagactgcagtcatcctgtgtctgctgctg
tccagcacctacctgtcccccgcgtgggggcaggccaagattcctttggaaacagtgaag
ctgtgggcagacacctttggcggggacctgtatgacaccgtgaccaaatactcaggctct
ctcttgctgcagaagaaatataaggatgtggagcccagcctgaggatccaggaggtggat
ggcttggagctggtgaggaagttctcagaggacatggagaccatgctccgaaggaaagtg
gaggccgtgaagaatctggtagaggccgccgaggaggctgacctgaaccatgaattcaat
gaatctctggtgtttgactattacaacgcagccctggtcaacgagcgggatgccagtggc
gagcacgtggagctgggggctgagtttgtcctggagcccaacgcgcacttcagcaacctg
atggtgaacacgtccctcagcagcgtgcagctgcccaccaacgtgtacaacaaagaccca
gatattttaaatggagtctacatgtctgaagccttgaaccctgtttttgtggagaacttc
cagagagacccgacactaacctggcaatattttggcagctcaacgggattctttaggatc
tatccaggcatcaaatggacgcctgacgagaatggagtcatcaccttcgactgccgaaac
cgcggctggtacatacaagctgctacttctcccaaggatgtagtgatcgtggtggataca
agcggcagcatgaaggggctgcggatggccatcgccaagcacaccatcgccaccatcctg
gacactctgggagagaatgactttgttaatatcatcgcgtacaatgactacgtccattac
ctcgagccctgtttcaaagggatccttgttcaggcggatcgagataaccgtgagcatttc
aaacatcttgtgaacgagctgatggttaaaggtgtgggggccgtgggccaagccctgagg
gaagccttccacatcctgaagcagttccaagaggcccggcaaggaagcctctgcaatcag
gccatcatgctgatcacggacggggccatggaggactataagccagtgtttgagaagtac
aactggccagaccgcaaggtgcgagttttcacttaccttattgggagagaagtcactttt
gctgaccacctgaagtggatcgcgtgcaacaacaaaggctactacacgcagatctccact
ctggctgacgcccaggagaacgtgatggagtacctgcacgtgctcagccgccccatggtc
atcaaccacgaccacgacatcatctggaccgaagcctacatggacagcaagctcgtcacc
gcacaggcacagagcatgatgctcctcaccaccgtggccatgccagtcttcagcaaaaag
aatgaaacgcttggcgtgcatggatatgcctttttgaacaccaacaatgggtacattctc
tcacatcctgacctccgacccctgtacaaagaggggaagaaactaaaacccaaacctaac
tacaacagcgtggatctctctgaagtggagtgggaggaccgagctgaaatcctgagaaca
gccatgatcaatggggaaacaggttctctctctatggacgtgaaggttccgctggacaaa
gggaagagagttcttttcctgaccaatgactacttcttcacaggcatcagtgacacacct
ttcagtttgggagtggtgctgtcccagggccacggagagtacctcctcctggggaacaca
tctgtggaagaaggcctgcacgacctgctgcacccggacctgaccctggccagcgactgg
atctactgcatcacagatatcgaccccgaccaccggaagctcagccagctggaggccatg
gtccgctttctgacaggggaggacccagacctggagtgtgacaaggagctggtgcaggag
gtactgtttgatgcagtggtgacagcccccatggaagcctactggacagcgctggctctc
aacatctctgaggagtccgagcgcgtggcggacatggccttcctgggcacccgggcgggc
ctcctccgaagcagcttgttcgtgggctctgagaagctctccgacaagaagttcctgacc
gctgaggacaaggccagcgtgtttaccatggaccacttccctctgtggtaccgccaggcc
gccgagcagcctgctggcagctttgtcttcaacctcggctcagcagaggggccagaaggt
ccagatgagccggtggtagtaacagcaagcacagctgtagccgtgacagtggacaagaag
acagccattgctgcagcggtgggcatccaattgaggctggacttcctgcagcgcagattc
tgggcagccgtgaggcagtgcagtgcgggggatgggccgtgcccgaagagctgccgggag
agtgacctggactgcttcatcatcgacaacaacgggttcattctgatctcagagaggtcc
cgggagatgggaagatttctgggggaggtggacggtgctctcatgacccagctgctcagc
acgggggcgttcagccaagtgaccatgtacgactaccaggccatgtgcaagcccccgagt
caccaccacagcgccgcccggcccctggtcagtcccatctctgccctcctgactgcgacc
agatggctggtgaatgaactcttgctgtga

KEGG   Miniopterus natalensis: 107546425
Entry
107546425         CDS       T05883                                 

Gene name
CACNA1C
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04020  Calcium signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna04270  Vascular smooth muscle contraction
mna04713  Circadian entrainment
mna04720  Long-term potentiation
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna04728  Dopaminergic synapse
mna04742  Taste transduction
mna04911  Insulin secretion
mna04912  GnRH signaling pathway
mna04921  Oxytocin signaling pathway
mna04924  Renin secretion
mna04925  Aldosterone synthesis and secretion
mna04927  Cortisol synthesis and secretion
mna04929  GnRH secretion
mna04930  Type II diabetes mellitus
mna04934  Cushing syndrome
mna04935  Growth hormone synthesis, secretion and action
mna05010  Alzheimer disease
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05031  Amphetamine addiction
mna05410  Hypertrophic cardiomyopathy
mna05412  Arrhythmogenic right ventricular cardiomyopathy
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107546425 (CACNA1C)
   04020 Calcium signaling pathway
    107546425 (CACNA1C)
   04024 cAMP signaling pathway
    107546425 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    107546425 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107546425 (CACNA1C)
   04929 GnRH secretion
    107546425 (CACNA1C)
   04912 GnRH signaling pathway
    107546425 (CACNA1C)
   04921 Oxytocin signaling pathway
    107546425 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    107546425 (CACNA1C)
   04924 Renin secretion
    107546425 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    107546425 (CACNA1C)
   04927 Cortisol synthesis and secretion
    107546425 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107546425 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    107546425 (CACNA1C)
   04270 Vascular smooth muscle contraction
    107546425 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    107546425 (CACNA1C)
   04727 GABAergic synapse
    107546425 (CACNA1C)
   04725 Cholinergic synapse
    107546425 (CACNA1C)
   04728 Dopaminergic synapse
    107546425 (CACNA1C)
   04726 Serotonergic synapse
    107546425 (CACNA1C)
   04720 Long-term potentiation
    107546425 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    107546425 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    107546425 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107546425 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107546425 (CACNA1C)
   05020 Prion disease
    107546425 (CACNA1C)
   05022 Pathways of neurodegeneration - multiple diseases
    107546425 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    107546425 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107546425 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107546425 (CACNA1C)
   05414 Dilated cardiomyopathy
    107546425 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107546425 (CACNA1C)
   04934 Cushing syndrome
    107546425 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107546425 (CACNA1C)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107546425 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel DUF4834
Other DBs
NCBI-GeneID: 107546425
NCBI-ProteinID: XP_016080296
LinkDB
Position
Unknown
AA seq 1929 aa
MVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIAAEDDPSPCALETGHGRQCQ
NGTVCKPGWDGPRHGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYFVT
LIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDI
DPENEDEGMDEEKPRNRGAPAGLLDQKKGKFAWFSHSTETHVSMPTSETESVNTENVAGG
DIEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIA
SEHYNQPHWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILE
TILVETKVMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFI
IIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGP
SFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARPA
RTASPEKKQEAVEKPTVEETKEEKIELKSITADGESPPTTKINVDDLQPNENEDKSVYPN
PETTGEEEEEEPEMPVGPRPRPLSELHLKEKAAPMPEASAFFIFSPTNRFRLQCHRIVND
SIFTNLILFFILLSSISLAAEDPVQHTSFRNHILFYFDIVFTTIFTIEIALKMTAYGAFL
HKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVV
QCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSDSSKQTEAECKGNYITYKDG
EVDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYR
VEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPL
RRYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCLFKIAMNILNMLFT
GLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVILSETNHYFCDAWNTFDALIV
VGSIVDIAITEVNPTEHTQCSPFMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLW
TFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFR
CATGEAWQDIMLACMPGKKCAPESEPHNSTEGETPCGSSFAVFYFISFYMLCAFLIINLF
VAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFG
KLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIKK
IWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSL
QAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVSYYQ
SDSRSAFPQTFTTQRPLHINKATNSPGDTESPSHEKLVDSTFTPSSYSSTGSNANINNAN
NTALGRFPRPTGYPSTVSAVEGHGPPLSPAIRVQEASWKLSSKRCHSRESQIAMVCREEF
SQDETYDVRMGEDAEYCSEPSLVSTEKLSYQDDENRQLTPPEEDKRDIRQSPKRSFLRSA
SLGRRASFHLECLKRQKHQGGDISQKTVLPLHLVHHQALAVAGLSPLLQRSHSPTTFPRP
CATPPAMPGSRGWPPQPIPTLQLEGTESSEKLNSSFPSVHCSSWSVEPTPCEGGSSATRR
ARPVSLTVPGQAGAWGRQFHGSASSLVEAVLISEGLGQFAQDPKFIEVTTQELADACDMT
IEEMENAADNILSGGAQQSPNGTLLPFVNCRDRGQDRAGGEEDGPCGPSQECRRSEEELQ
DSRAYVSSL
NT seq 5790 nt   +upstreamnt  +downstreamnt
atggtccccctgctgcacatcgccctgctagtgctgttcgtcatcatcatctacgccatc
attggcctggagctcttcatggggaagatgcataagacctgctacaaccaggagggcata
gcagcagaagatgacccctccccttgtgctctggagacgggccacgggcggcagtgtcag
aatggcactgtgtgcaagcccggctgggacgggcccaggcacggcatcaccaacttcgac
aacttcgccttcgccatgctgacggtgttccagtgcatcaccatggagggctggacggac
gtgctgtactgggtcaatgatgccgtaggaagggactggccctggatctattttgttaca
ctaatcatcatagggtcattttttgtacttaacttggttctcggtgtccttagcggagag
ttctccaaagagagggagaaggccaaggctcggggagatttccaaaagctgcgagagaag
caacagctggaagaggacctgaaaggctatctggactggatcacacaggcggaagacatc
gaccccgagaatgaagatgaaggcatggatgaggagaaaccccgaaacagaggagctcca
gcaggcttgctcgatcagaagaaagggaagtttgcttggtttagtcactccacagaaacc
catgtgagcatgcccacaagtgagacggagtctgtcaacactgagaacgtggctggcggt
gacatcgagggagaaaactgtggggccaggctggcccaccgaatctccaagtcgaagttc
agtcgctactggcgccggtggaatcggttctgcagaagaaagtgtcgcgccgcagtcaag
tccaacgtcttctactggctggtgattttcctggtgttcctcaacacgctcaccattgcc
tcagagcattacaaccagcctcactggctcacagaagtccaagacacggccaacaaggca
ctcctggcccttttcactgcagagatgctgctgaagatgtacagcctgggcctgcaggcc
tacttcgtgtccctcttcaaccgcttcgactgcttcatcgtgtgcggaggcatcctggag
accatcctggtggagaccaaggttatgtctcccttgggcatctctgtgctgagatgcgtt
cggctcctgaggatatttaaaatcaccaggtactggaactccttaagcaacctggtagca
tccttgctgaactccgtgcgctccatcgcctccctgctgctgctcctcttcctcttcatc
atcatcttctccctcctggggatgcagctcttcggaggaaagttcaactttgatgagatg
cagacccggaggagcacatttgataacttcccccagtccctcctgaccgtgtttcagatc
ctgaccggggaggactggaattcggtgatgtatgatgggatcatggcttatggcggcccc
tcttttccagggatgttagtctgtatttacttcatcatcctcttcatctgtggaaactat
atcctactgaatgtgttcttggccattgctgtggacaacctggctgatgctgagagcctc
acatctgcccaaaaggaggaagaagaagaaaaggagagaaagaagctggccagaccggcc
aggactgccagcccagagaagaaacaggaggcggtggagaagccgacagtggaggagacc
aaggaggagaaaatcgagctgaaatccatcacagctgacggagagtccccacccaccacc
aagatcaacgtggatgacctgcagcccaatgaaaatgaggacaagagtgtctaccccaac
ccagaaacgacaggagaagaggaggaggaggagcctgagatgcctgtgggccctcgccca
cgccctctctctgagctgcaccttaaggaaaaggcagcgcccatgcctgaagccagtgca
tttttcatcttcagccccaccaacaggtttcgcctccagtgccaccgcattgtcaatgac
tcgatcttcaccaatctgatcctcttcttcatcctgctcagcagcatttccctggctgct
gaggaccccgtccagcacacctccttcaggaaccatattctgttttattttgatattgtt
tttactaccattttcaccattgaaattgctctgaagatgactgcttatggggctttcttg
cacaagggctccttttgccggaactacttcaacatcttggacctgctagtggtcagcgtg
tccctcatctcctttggcatccagtccagtgcaatcaacgtcgtaaagatcttgcgagtt
ctgcgagtactcaggcccctgagagccatcaacagagccaagggactaaagcatgtggtc
cagtgtgtgtttgtcgccatccggaccattggcaacatcgtgattgtcaccacactgctt
cagttcatgttcgcctgcatcggggtccagctcttcaagggaaagctctacacctgttca
gacagctccaagcagaccgaggcagaatgcaagggtaactacattacatacaaggacggg
gaggttgaccaccccatcatacagccccgcagctgggagaacagcaagtttgactttgac
aatgtcctggcagccatgatggctctcttcacggtctccacctttgaggggtggccagag
ctgctgtaccgctccatcgactcccacacggaagacaagggccccatctacaactaccgc
gtggagatctccatcttcttcatcatctacatcatcatcattgccttcttcatgatgaac
atcttcgtgggtttcgtcatcgtcaccttccaggaacagggagagcaggagtacaagaac
tgtgagctggacaaaaaccagcgacagtgtgtggaatacgccctgaaggcccggcccctg
cggaggtacatacccaagaaccagcaccagtacaaagtgtggtatgtggtcaactccacc
tacttcgagtacctgatgttcgtactcatcctgctcaacaccatctgcttggccatgcag
cactacggtcagagctgcctgtttaaaatcgccatgaacatcctcaacatgctcttcact
ggcctcttcactgtggagatgattctgaagcttattgcctttaaacccaagggttacttt
agtgatccctggaatgtttttgacttcctcatcgtaattggcagcataattgacgtcatt
ctcagtgaaactaatcactatttctgtgatgcatggaatacgtttgacgccttgattgtt
gtgggtagcattgttgatatagcaatcaccgaggtaaacccaactgaacatacccaatgc
tctccctttatgaacgcagaggagaactcccgcatctccatcaccttcttccgcctcttc
cgggtcatgcgcctggtcaagctgctgagccgtggggagggcatccggaccctgctgtgg
accttcatcaagtccttccaggccctgccctacgtggcccttctcatagtgatgttgttc
ttcatctatgccgtgatcgggatgcaggtgtttgggaaaattgccctgaacgacaccacg
gagatcaaccggaacaacaactttcagaccttcccccaagctgtgctgctcctcttcagg
tgtgccactggggaggcgtggcaggacatcatgctggcctgcatgccagggaagaagtgc
gccccggagtctgagccccacaacagcacggaaggggagacgccctgtggcagcagcttc
gccgtcttctacttcatcagcttctacatgctctgtgccttcctgatcatcaacctcttt
gtagctgtcatcatggacaactttgactacctgacaagggactggtcaatccttggtccc
caccatctggacgaatttaaaagaatctgggcagagtatgaccctgaagccaagggtcgc
atcaaacacctggatgtggtgaccctgctccggcggattcagcccccactgggttttggg
aagctgtgccctcaccgtgtggcttgcaaacgtctggtctccatgaacatgcctctgaac
agtgatgggacggtcatgttcaatgccaccctatttgccctggtccggacagccctgagg
atcaaaacggaagggaacctggaacaagccaatgaggagctccgggccataatcaagaag
atctggaagcggaccagcatgaagctgctggaccaagtggtgccccccgcgggtgatgat
gaggtcacagttggcaagttttatgctactttcctgatccaagagtacttccggaaattc
aagaagcgcaaggagcagggcctcgtgggcaagccctcccagaggaacgccttgtccctg
caggctggcttgcgcacgctgcacgacatcgggcctgagatccgacgggccatctccgga
gatctgacagctgaggaggagctggacaaagccatgaaggaggctgtgtctgctgcctct
gaagatgacatcttcaggagggccggtggcctgttcggcaaccatgtcagctactaccaa
agcgacagccggagcgccttcccccagaccttcaccacccagcgcccactgcacatcaac
aaggccactaacagcccaggcgacaccgagtctccgtcccacgagaaattggtggactcc
accttcacccccagcagctactcatccactggctccaacgccaacatcaacaatgccaac
aacactgccctgggccgctttccccgccccaccggctaccccagcaccgtcagtgctgtg
gagggccacgggccccccttgtctcctgccatccgggtgcaggaggcttcgtggaagctc
agctccaagaggtgccactcccgggagagccagatagccatggtgtgtcgggaggagttt
tctcaggacgagacctatgacgtgaggatgggtgaagacgcagagtactgcagtgagccc
agcctggtctccacagagaagctctcctatcaggatgatgaaaaccgacaactgacaccc
ccagaggaggacaagagggacatccggcagtctccaaagaggagcttcctccgctctgcc
tccctaggtcgaagggcctccttccacctggaatgtctaaagcgacagaagcatcaaggg
ggagacatatctcagaagacagtcctgcccttacatctggttcatcaccaggcattggca
gtggcaggcctgagccccctcctccagagaagccattctcccaccaccttccccaggcca
tgtgccacgccccctgccatgcccggcagccgaggctggcccccgcagcccatccccacc
ctgcagctcgaaggaaccgagtccagcgagaaactcaacagcagcttcccgtccgtccac
tgcagctcctggtccgtggagcccacgccttgtgagggtggcagcagcgccacccggaga
gcccggcctgtgtccctcactgtgcccggccaggcgggtgcctggggcaggcagttccac
ggtagcgccagcagtctggtggaagcggtcttgatttcggaaggactggggcagtttgcc
caagatcccaagtttatcgaggtcacaacccaggagctggctgacgcctgtgacatgacc
atagaggagatggagaacgctgctgacaacatcctcagtgggggcgcccagcagagcccc
aacggcaccctattaccttttgttaactgcagggaccgggggcaggacagagcagggggc
gaagaggacgggccctgtgggcccagccaggagtgccggaggagcgaggaggagctgcag
gacagcagagcctacgtcagcagcctgtag

DBGET integrated database retrieval system