KEGG   Miniopterus natalensis: 107527219
Entry
107527219         CDS       T05883                                 

Gene name
GSK3B
Definition
(RefSeq) glycogen synthase kinase-3 beta isoform X1
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
mna  Miniopterus natalensis
Pathway
mna01521  EGFR tyrosine kinase inhibitor resistance
mna04012  ErbB signaling pathway
mna04062  Chemokine signaling pathway
mna04110  Cell cycle
mna04150  mTOR signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04310  Wnt signaling pathway
mna04340  Hedgehog signaling pathway
mna04360  Axon guidance
mna04390  Hippo signaling pathway
mna04510  Focal adhesion
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04657  IL-17 signaling pathway
mna04660  T cell receptor signaling pathway
mna04662  B cell receptor signaling pathway
mna04722  Neurotrophin signaling pathway
mna04728  Dopaminergic synapse
mna04910  Insulin signaling pathway
mna04916  Melanogenesis
mna04917  Prolactin signaling pathway
mna04919  Thyroid hormone signaling pathway
mna04931  Insulin resistance
mna04932  Non-alcoholic fatty liver disease
mna04934  Cushing syndrome
mna04935  Growth hormone synthesis, secretion and action
mna05010  Alzheimer disease
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05135  Yersinia infection
mna05160  Hepatitis C
mna05162  Measles
mna05163  Human cytomegalovirus infection
mna05165  Human papillomavirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05200  Pathways in cancer
mna05210  Colorectal cancer
mna05213  Endometrial cancer
mna05215  Prostate cancer
mna05217  Basal cell carcinoma
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107527219 (GSK3B)
   04310 Wnt signaling pathway
    107527219 (GSK3B)
   04340 Hedgehog signaling pathway
    107527219 (GSK3B)
   04390 Hippo signaling pathway
    107527219 (GSK3B)
   04151 PI3K-Akt signaling pathway
    107527219 (GSK3B)
   04150 mTOR signaling pathway
    107527219 (GSK3B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107527219 (GSK3B)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107527219 (GSK3B)
   04550 Signaling pathways regulating pluripotency of stem cells
    107527219 (GSK3B)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    107527219 (GSK3B)
   04657 IL-17 signaling pathway
    107527219 (GSK3B)
   04662 B cell receptor signaling pathway
    107527219 (GSK3B)
   04062 Chemokine signaling pathway
    107527219 (GSK3B)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107527219 (GSK3B)
   04917 Prolactin signaling pathway
    107527219 (GSK3B)
   04935 Growth hormone synthesis, secretion and action
    107527219 (GSK3B)
   04919 Thyroid hormone signaling pathway
    107527219 (GSK3B)
   04916 Melanogenesis
    107527219 (GSK3B)
  09156 Nervous system
   04728 Dopaminergic synapse
    107527219 (GSK3B)
   04722 Neurotrophin signaling pathway
    107527219 (GSK3B)
  09158 Development and regeneration
   04360 Axon guidance
    107527219 (GSK3B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107527219 (GSK3B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107527219 (GSK3B)
   05225 Hepatocellular carcinoma
    107527219 (GSK3B)
   05226 Gastric cancer
    107527219 (GSK3B)
   05217 Basal cell carcinoma
    107527219 (GSK3B)
   05215 Prostate cancer
    107527219 (GSK3B)
   05213 Endometrial cancer
    107527219 (GSK3B)
   05224 Breast cancer
    107527219 (GSK3B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107527219 (GSK3B)
   05020 Prion disease
    107527219 (GSK3B)
   05022 Pathways of neurodegeneration - multiple diseases
    107527219 (GSK3B)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107527219 (GSK3B)
   04931 Insulin resistance
    107527219 (GSK3B)
   04934 Cushing syndrome
    107527219 (GSK3B)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107527219 (GSK3B)
  09172 Infectious disease: viral
   05160 Hepatitis C
    107527219 (GSK3B)
   05162 Measles
    107527219 (GSK3B)
   05163 Human cytomegalovirus infection
    107527219 (GSK3B)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107527219 (GSK3B)
   05165 Human papillomavirus infection
    107527219 (GSK3B)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107527219 (GSK3B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107527219 (GSK3B)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107527219 (GSK3B)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     107527219 (GSK3B)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   107527219 (GSK3B)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    107527219 (GSK3B)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1
Other DBs
NCBI-GeneID: 107527219
NCBI-ProteinID: XP_016055389
LinkDB
Position
Unknown
AA seq 450 aa
MSGRPRTTSFAESCKPVQQPSAFGSLKVSSSLDKKNKTRFPVTKFAGDKDGSKVTTVVAT
PGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRK
LDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMY
QLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYR
APELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIRE
MNPNYTEFKFPQIKAHPWTKDSSGTGHFNSGVRVFRPRTPPEAIALCSRLLEYTPTARLT
PLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAAST
PTNSTAASDANVGDRGQTNSAASASASNST
NT seq 1353 nt   +upstreamnt  +downstreamnt
atgtcagggcggcccagaaccacctcctttgcggagagctgcaagccagtgcagcagcct
tcagcttttggcagcctgaaagttagcagttcattggataaaaagaacaagacacggttt
cctgtcactaagtttgcaggagacaaggatggcagtaaggtgaccacagtggtggcaact
ccggggcagggtccagacaggccacaagaagtcagctatacagacactaaagtgattgga
aatgggtcatttggtgtggtatatcaagccaaactttgtgattcaggagaattagttgcc
atcaagaaagtattgcaggacaagagatttaagaaccgagagctccaaatcatgagaaag
ctagatcactgtaacatagtccgattgcgttatttcttctactcaagtggtgagaagaaa
gatgaggtctatctcaatctggtgctggactatgttccggaaacagtatacagagttgcc
agacactatagtcgagccaaacagacgcttcctgtgatctatgtcaagttgtatatgtat
cagctattccgaagtttagcctatattcattcctttggaatctgccatcgggatattaaa
ccacagaacctcttgttggaccctgatacagctgtattaaaactctgtgactttggaagt
gcaaagcagctggtccgaggagaacccaatgtttcgtatatctgttctcggtactatagg
gcaccagagttgatctttggagccactgattatacctctagtatagatgtatggtctgca
ggctgtgtgctggctgagctgttgctaggacaaccaatatttccaggggacagtggtgtg
gatcaattggtggaaataatcaaggtcctggggacaccaacaagggagcaaattagagaa
atgaacccaaactacacagaattcaaatttcctcaaattaaggcacatccttggactaag
gattcgtcaggaacaggacatttcaactcaggagtgcgggtctttcgaccccgaactcca
ccagaggcaattgcactgtgtagccgtctgctggagtatacaccaactgcccgattgaca
ccactggaagcttgtgcacattcattttttgatgaattacgggacccaaatgtcaaacta
ccaaatgggcgagacacacctgcactcttcaactttaccactcaagaactgtcaagtaat
ccacctctagctaccatccttattcctcctcatgctcggattcaagcagctgcttcaacc
ccaacaaattccacagcagcctcagatgctaatgttggagaccgtggacagaccaatagc
gccgcttctgcatcagcttccaactccacctga

DBGET integrated database retrieval system