KEGG   Miniopterus natalensis: 107527227
Entry
107527227         CDS       T05883                                 

Gene name
IFNG
Definition
(RefSeq) interferon gamma
  KO
K04687  interferon gamma
Organism
mna  Miniopterus natalensis
Pathway
mna03050  Proteasome
mna04060  Cytokine-cytokine receptor interaction
mna04066  HIF-1 signaling pathway
mna04217  Necroptosis
mna04350  TGF-beta signaling pathway
mna04380  Osteoclast differentiation
mna04612  Antigen processing and presentation
mna04630  JAK-STAT signaling pathway
mna04650  Natural killer cell mediated cytotoxicity
mna04657  IL-17 signaling pathway
mna04658  Th1 and Th2 cell differentiation
mna04659  Th17 cell differentiation
mna04660  T cell receptor signaling pathway
mna04940  Type I diabetes mellitus
mna05140  Leishmaniasis
mna05142  Chagas disease
mna05143  African trypanosomiasis
mna05144  Malaria
mna05145  Toxoplasmosis
mna05146  Amoebiasis
mna05152  Tuberculosis
mna05160  Hepatitis C
mna05164  Influenza A
mna05168  Herpes simplex virus 1 infection
mna05200  Pathways in cancer
mna05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mna05321  Inflammatory bowel disease
mna05322  Systemic lupus erythematosus
mna05323  Rheumatoid arthritis
mna05330  Allograft rejection
mna05332  Graft-versus-host disease
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    107527227 (IFNG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    107527227 (IFNG)
   04630 JAK-STAT signaling pathway
    107527227 (IFNG)
   04066 HIF-1 signaling pathway
    107527227 (IFNG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107527227 (IFNG)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107527227 (IFNG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107527227 (IFNG)
   04612 Antigen processing and presentation
    107527227 (IFNG)
   04660 T cell receptor signaling pathway
    107527227 (IFNG)
   04658 Th1 and Th2 cell differentiation
    107527227 (IFNG)
   04659 Th17 cell differentiation
    107527227 (IFNG)
   04657 IL-17 signaling pathway
    107527227 (IFNG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107527227 (IFNG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107527227 (IFNG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107527227 (IFNG)
  09172 Infectious disease: viral
   05160 Hepatitis C
    107527227 (IFNG)
   05164 Influenza A
    107527227 (IFNG)
   05168 Herpes simplex virus 1 infection
    107527227 (IFNG)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107527227 (IFNG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107527227 (IFNG)
   05144 Malaria
    107527227 (IFNG)
   05145 Toxoplasmosis
    107527227 (IFNG)
   05140 Leishmaniasis
    107527227 (IFNG)
   05142 Chagas disease
    107527227 (IFNG)
   05143 African trypanosomiasis
    107527227 (IFNG)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107527227 (IFNG)
   05323 Rheumatoid arthritis
    107527227 (IFNG)
   05321 Inflammatory bowel disease
    107527227 (IFNG)
   05330 Allograft rejection
    107527227 (IFNG)
   05332 Graft-versus-host disease
    107527227 (IFNG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107527227 (IFNG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107527227 (IFNG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mna03051]
    107527227 (IFNG)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mna04052]
    107527227 (IFNG)
   00536 Glycosaminoglycan binding proteins [BR:mna00536]
    107527227 (IFNG)
Proteasome [BR:mna03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    107527227 (IFNG)
Cytokines and growth factors [BR:mna04052]
 Cytokines
  Interferons
   107527227 (IFNG)
Glycosaminoglycan binding proteins [BR:mna00536]
 Heparan sulfate / Heparin
  Cytokines
   107527227 (IFNG)
SSDB
Motif
Pfam: IFN-gamma API5 PAZ_siRNAbind
Other DBs
NCBI-GeneID: 107527227
NCBI-ProteinID: XP_016055408
LinkDB
Position
Unknown
AA seq 166 aa
MNFTSYILAFQLCVILASSSCYGQSTILNETEKLKKYFNASNSDVGNGGALFSDILNNWK
GETDIKIIQSQVVSFYFKLFENFKDNELIQSSMEIIKEELRVKFFNSSNSKLEDFKKLSQ
IPVNDVAIQRKAMSELYKVISELSPKAGLRKRKRSQTLFRGWRASK
NT seq 501 nt   +upstreamnt  +downstreamnt
atgaattttacaagttatatcttagcttttcagctttgtgtgatcttggcttcttctagc
tgctacggccagtccacaatccttaacgaaacagaaaaactaaagaaatattttaatgca
agtaattcagatgtaggaaatggtggagcccttttctcagatattttgaacaattggaaa
ggggagactgacataaaaataattcagagccaagttgtctccttctacttcaaactcttt
gaaaactttaaagataatgagctcattcaaagtagcatggagattatcaaggaagagctg
cgtgttaaattcttcaacagcagcaacagcaaactggaagacttcaagaagctgagtcaa
attccggtgaatgatgtggccatccagcgcaaagcgatgagtgaactctacaaagtgata
agtgagctgtcaccaaaagctggcctaaggaagagaaagaggagtcagactctgtttcgt
ggctggagagcatcgaaataa

DBGET integrated database retrieval system