KEGG   Miniopterus natalensis: 107527253
Entry
107527253         CDS       T05883                                 

Gene name
AVPR1A
Definition
(RefSeq) vasopressin V1a receptor
  KO
K04226  arginine vasopressin receptor 1A
Organism
mna  Miniopterus natalensis
Pathway
mna04020  Calcium signaling pathway
mna04072  Phospholipase D signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107527253 (AVPR1A)
   04072 Phospholipase D signaling pathway
    107527253 (AVPR1A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107527253 (AVPR1A)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107527253 (AVPR1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107527253 (AVPR1A)
G protein-coupled receptors [BR:mna04030]
 Rhodopsin family
  Peptide
   Vasopressin
    107527253 (AVPR1A)
SSDB
Motif
Pfam: 7tm_1 DUF1856 7TM_GPCR_Srsx 7TM_GPCR_Srv 7TM_GPCR_Srx 7tm_4 7TM_GPCR_Srw
Other DBs
NCBI-GeneID: 107527253
NCBI-ProteinID: XP_016055447
LinkDB
Position
Unknown
AA seq 420 aa
MDSMRFDRGPGAGPAGNSSRWWPTTGGANTTAETEALGEGAGSKRDARNEELAKLEIAVL
AVTFVVAVVGNSSVLLALRRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQLCWDITYRFR
GPDGLCRVVKHLQVFVMFVSAYMLVVMTADRYIAVCHPMKTLQQPARRSRLMIAAAWALS
FVLSTPQYFVFSVVEVDNVTKARDCWATFIQPWGSRAYVTWMTGGIFVAPVVILGTCYGF
ICYHIWRNVRGKTASREGKGAAGAGGAFHSGLLLEPCVSSVKTISRAKIRTVKMTFVIVT
AYIVCWTPFFIVQMWSVWDENLPWVESENPAITITALLASLNSCCNPWIYMFFSGHLLQD
CVQSFLCCQNMKQAFNKEDSDSMSRRQTSYTNNRSPTNSLGPWKDSPKSSRFIKFIPVST
NT seq 1263 nt   +upstreamnt  +downstreamnt
atggacagcatgcgtttcgacagaggccccggtgcggggcccgcgggcaactccagccgg
tggtggccgaccaccggcggcgccaacaccactgcggagacggaggcgctcggggaaggc
gcggggtccaagagggacgcgcgcaacgaggagctggccaagctggagatcgcggtgcta
gctgtgacgttcgtggtggccgtggtgggcaacagcagcgtgttgctggcgctgcgccgc
acgccccgcaagacgtcccgcatgcacctgttcatccgccacctcagcctggcagacctg
gccgtggctttcttccaggtgctgccgcagctgtgctgggacatcacctaccgcttccgg
ggccccgacgggctgtgccgcgtggtgaagcacctgcaggtgttcgtcatgttcgtgtcg
gcctacatgctggtggtcatgaccgccgaccgctacatcgccgtgtgccacccgatgaag
acgctgcagcagcccgcgcgccgctcgcgcctcatgatcgccgccgcctgggcgctgagc
ttcgtgctgagcacgccgcagtacttcgtcttctccgtggtcgaggtggacaacgtcacc
aaggcccgcgactgctgggccaccttcatccagccctggggctcccgcgcctacgtgacc
tggatgaccggcggcatcttcgtggccccggtggtcatcctgggcacctgctacggcttc
atctgctaccacatctggcgcaacgtccgcggaaagacggcgtcgcgcgagggcaagggc
gcggcgggcgcgggcggcgccttccacagcgggctcctgctcgagccctgcgtcagcagc
gtgaagaccatctcccgcgccaagatccgcacggtgaagatgactttcgtgatcgtgacg
gcgtacatcgtctgctggacgccgttcttcatcgtccagatgtggtcggtctgggatgag
aacctcccctgggtcgagtccgaaaaccctgccatcaccatcactgcgctgctggcttcc
ttgaatagttgctgcaacccctggatatacatgttttttagtggccatctcctgcaagac
tgtgtccaaagcttcctgtgctgccaaaacatgaagcaagcattcaacaaagaagattct
gacagtatgagcaggagacagacttcttacactaacaaccgaagcccgacaaacagtctg
ggtccttggaaggactcacctaaatcttccaggttcatcaaatttatccctgtttcaacc
tga

KEGG   Miniopterus natalensis: 107539423
Entry
107539423         CDS       T05883                                 

Gene name
AVPR1B
Definition
(RefSeq) vasopressin V1b receptor
  KO
K04227  arginine vasopressin receptor 1B
Organism
mna  Miniopterus natalensis
Pathway
mna04020  Calcium signaling pathway
mna04072  Phospholipase D signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107539423 (AVPR1B)
   04072 Phospholipase D signaling pathway
    107539423 (AVPR1B)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107539423 (AVPR1B)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107539423 (AVPR1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107539423 (AVPR1B)
G protein-coupled receptors [BR:mna04030]
 Rhodopsin family
  Peptide
   Vasopressin
    107539423 (AVPR1B)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srv Srg DUF1856 Git3
Other DBs
NCBI-GeneID: 107539423
NCBI-ProteinID: XP_016071405
LinkDB
Position
Unknown
AA seq 424 aa
MDPGPARATNPVPGGTLSAPNATTPWLGRDEELAKAEIGVLAVVLVLTTWGNLTVLLMLS
QQGRKRSRMHLFVLHLALTDLGVALFQVLPQLLWDITYRFQGPDLLCRAVKYLQALSMFA
STYMLLAMTLDRYLAVCHPLRSLQQPSQSTYPLIAAPWLLAAIFSLPQVFIFSLREVIQG
SGVLDCWADFRFPWGPQAYITWTALAIFILPVAMLTACYSLICYEICKNLKVKTQTCRVE
GGGWRTWGRASPPAPAVATRGLPSRVSSISTISRAKVRTVKMTFIIVLAYIACWTPFFSV
QMWTVWDESAPDEDSTNVVFTISMLLGNLSSCCNPWIYMGFNSHLWPHPLRLLACCVGPR
SGVRRQLSNGSFSSRPTLLLTHSSSPPTLSLSPSLSLSGTPGPEESLKDSEQVDRDSATE
TDIF
NT seq 1275 nt   +upstreamnt  +downstreamnt
atggatcctgggcctgcccgggccaccaaccccgttcccgggggcaccctctctgccccc
aatgccactaccccctggctgggccgcgatgaggagctggccaaagcggagatcggagtc
ctggccgtggtcctggtgctgacgacgtggggcaacctgactgtgctgctgatgctgagc
cagcagggccgcaagcgctcccgcatgcacctgtttgtgctgcacctggccctgaccgac
ctgggtgtggcgctcttccaggtgctgccccagctgctgtgggacatcacctaccgcttc
cagggccccgacctcctctgccgggccgtcaagtacctgcaggcgctcagcatgttcgcc
tccacctacatgctgctggccatgacgctggaccgctacctggccgtgtgtcaccccctg
cggagcctccagcagcccagccagtctacctacccgctcatcgctgcgccctggctgctg
gccgccatcttcagcctccctcaagtcttcatttttagtttgcgggaagtgatccaaggt
tcgggggtgttggactgctgggcagacttccgcttcccctgggggccgcaggcctacatc
acctggactgcgttggccatctttatcctgccagtggccatgctcacagcctgctacagc
ctcatctgctacgagatctgtaagaacctgaaagtcaagacacagacctgcagggtggaa
ggagggggctggaggacttggggcagggcttcgcctcctgccccagctgtagccacgagg
gggctgccatctcgggtcagcagtatcagcactatctccagggccaaggtccggaccgtg
aagatgaccttcatcattgtcttggcctacattgcctgctggacaccctttttcagcgtc
cagatgtggactgtgtgggacgagagtgcccctgatgaagattcgaccaatgtggttttc
accatctccatgcttctgggcaacctcagcagctgctgcaacccctggatctacatgggc
ttcaacagccacctgtggccgcaccccttacgccttctggcctgctgtgtgggtcctcga
tctggggtgcgcaggcagctctccaacggcagcttctccagccgccccacgctgctgctg
acccactccagctccccgcccaccctcagcctcagccccagcctcagcctcagtgggacg
cccggacctgaagagtcactaaaggactcagagcaggtggacagggacagtgccactgag
actgacatcttttag

DBGET integrated database retrieval system