KEGG   Miniopterus natalensis: 107527336
Entry
107527336         CDS       T05883                                 

Gene name
CD80
Definition
(RefSeq) T-lymphocyte activation antigen CD80
  KO
K05412  CD80 antigen
Organism
mna  Miniopterus natalensis
Pathway
mna04514  Cell adhesion molecules
mna04620  Toll-like receptor signaling pathway
mna04672  Intestinal immune network for IgA production
mna04940  Type I diabetes mellitus
mna05320  Autoimmune thyroid disease
mna05322  Systemic lupus erythematosus
mna05323  Rheumatoid arthritis
mna05330  Allograft rejection
mna05332  Graft-versus-host disease
mna05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107527336 (CD80)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107527336 (CD80)
   04672 Intestinal immune network for IgA production
    107527336 (CD80)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107527336 (CD80)
   05323 Rheumatoid arthritis
    107527336 (CD80)
   05320 Autoimmune thyroid disease
    107527336 (CD80)
   05330 Allograft rejection
    107527336 (CD80)
   05332 Graft-versus-host disease
    107527336 (CD80)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107527336 (CD80)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107527336 (CD80)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mna04090]
    107527336 (CD80)
CD molecules [BR:mna04090]
 Proteins
  107527336 (CD80)
SSDB
Motif
Pfam: C2-set_2 Ig_3 V-set ig I-set Ig_2 Ig_6 TMIE
Other DBs
NCBI-GeneID: 107527336
NCBI-ProteinID: XP_016055594
LinkDB
Position
Unknown
AA seq 291 aa
MGQTKWGTPLPRFFQILVLTCLLYFSVTNQVTKQVNDRVVLSCNYNISADELTRVRIYWQ
KSTDVVLTVISGKVDLGSKYKNRTIPNIINDPSIVILGLRPSDSGTYTCVIQKPEKGAFV
LEHLISVLLFVKADFPAPSITELGNPSTHIKRIICSTSGGFPKPHLSWLENGKEINAINT
TVSQDPETELYTISSELDFNVTKNHSFSCFVKYGNLTVSQTFKWQKSEPPPPPSNPFWIW
ILISVFGSIIFVTVFVCCTCKRFSAKRRRNEESIEMERISPVYSGSIEASG
NT seq 876 nt   +upstreamnt  +downstreamnt
atgggtcaaacaaagtggggaacaccactacccaggttttttcagattttggtgctgact
tgtcttctttacttctcagtcaccaaccaggtaacgaagcaagtgaacgacagggtagta
ctatcctgtaattacaacatttctgctgatgaactgacaagagttcgcatctattggcaa
aaaagtactgatgtggtgctgactgtcatatctggaaaagtggacctggggtccaagtat
aagaaccgcaccatccctaacatcatcaatgacccttccattgtgatcctgggtctacgc
ccttcggacagtggtacatacacctgtgtcattcagaagcctgaaaaaggggctttcgta
ttggaacacttgatttcggtgctgttattcgtcaaagctgacttccctgccccaagtata
actgaacttggaaacccgtctactcacatcaaaagaataatctgttcaacctctggaggt
tttccaaagcctcacctctcctggttggaaaatggaaaagaaataaatgccatcaacaca
acggtttcccaagatcctgaaactgagctctacacgattagcagtgagctggatttcaat
gtgacaaaaaaccacagcttctcatgttttgtcaaatatggaaacttaacagtatcacag
accttcaaatggcaaaaatctgagccaccaccccctccttctaatccgttctggatctgg
atcttaatctcagtatttgggtctattatctttgttacagtattcgtatgctgcacatgc
aaaagattttctgcaaagagaaggaggaatgaggagagcatagaaatggaaaggatctcc
cctgtctactcaggatctatagaagcatcaggctga

KEGG   Miniopterus natalensis: 107527343
Entry
107527343         CDS       T05883                                 

Gene name
CD86
Definition
(RefSeq) T-lymphocyte activation antigen CD86
  KO
K05413  CD86 antigen
Organism
mna  Miniopterus natalensis
Pathway
mna04514  Cell adhesion molecules
mna04620  Toll-like receptor signaling pathway
mna04672  Intestinal immune network for IgA production
mna04940  Type I diabetes mellitus
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05202  Transcriptional misregulation in cancer
mna05320  Autoimmune thyroid disease
mna05322  Systemic lupus erythematosus
mna05323  Rheumatoid arthritis
mna05330  Allograft rejection
mna05332  Graft-versus-host disease
mna05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107527343 (CD86)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107527343 (CD86)
   04672 Intestinal immune network for IgA production
    107527343 (CD86)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    107527343 (CD86)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    107527343 (CD86)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107527343 (CD86)
   05323 Rheumatoid arthritis
    107527343 (CD86)
   05320 Autoimmune thyroid disease
    107527343 (CD86)
   05330 Allograft rejection
    107527343 (CD86)
   05332 Graft-versus-host disease
    107527343 (CD86)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107527343 (CD86)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107527343 (CD86)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107527343 (CD86)
   04090 CD molecules [BR:mna04090]
    107527343 (CD86)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107527343 (CD86)
CD molecules [BR:mna04090]
 Proteins
  107527343 (CD86)
SSDB
Motif
Pfam: V-set Ig_3 ig I-set Lep_receptor_Ig C2-set_2 CLN3 Ig_6
Other DBs
NCBI-GeneID: 107527343
NCBI-ProteinID: XP_016055598
LinkDB
Position
Unknown
AA seq 365 aa
MGLSTTLFVMAFLHSGAASMKSQAYFNETGELPCYFTNSQNISLNELVVFWQNQDKLVLY
ELFGGKENPKNVHPKYKGRTSLGQDNWTLQLHNVQIKDKGLYQCYIHHRKGPQGMISIHQ
MSIDLSVLANFSQPEIMLISNRTENSDIINLTCSSVQGYPKPKKMFFLKKTMNSTTECDG
VTKVFQNNITELYNVSISSPFPVSPETNVSIFCVLQPETTQTQLFSQPYNIDAKPPQPPQ
PAQDFVVLTACLIIVIFPLVFVASYLILKKMKKPRPSHECEVAQAEEEESEQERVENRVP
ERSDEAQCVNISETASGSVRKADELRIWETRRGRDGSTLDPGAISMLVVADIEEDTRAQQ
AIAKP
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgggattgagtaccactctctttgtgatggccttcctgcactctggtgctgcttccatg
aagagtcaagcgtatttcaacgagactggagaacttccatgctactttacaaactctcaa
aacataagcctgaatgagctggtagtattttggcagaaccaggataagctggttctgtat
gagctatttggaggcaaagagaatcctaaaaatgttcatcccaagtacaagggccgcaca
agcttgggccaggataattggaccctgcaactacacaatgttcagatcaaggacaaaggc
ttgtatcaatgctacatccatcatcgcaaagggccccaaggaatgatttccatccaccaa
atgagtattgacctatcagtgcttgccaacttcagtcaacctgaaataatgctaatttct
aatagaacagaaaattctgacatcataaatttgacctgctcatctgtacaaggttaccca
aaacctaagaagatgttttttctgaaaaaaaccatgaattcaactactgagtgtgatggt
gtcacgaaagtatttcaaaataacatcacagaactatacaacgtttctatcagctcgcct
tttccagtgtctcctgaaacaaatgtgagcatcttctgtgtcctgcaacctgagacaaca
cagacacagcttttctctcaaccttacaatatagatgcaaagccacctcagccacctcag
cctgcccaagactttgtcgtcctgactgcttgtttaataattgtgatattcccacttgtg
tttgtggcgtcctatctaatactaaagaaaatgaagaagcctcgcccctctcatgaatgt
gaagtcgcccaagcagaagaggaagagagcgaacaggaaagagtagaaaaccgtgtacct
gaaaggtctgacgaagcccaatgtgttaacatttcggagacagcctcagggtcagtgagg
aaagcagacgaactcagaatttgggagactaggagaggcagagatggaagcactctggat
cctggagccatttccatgttggttgttgctgacattgaagaggacacacgtgcccaacaa
gctatcgctaagccttag

DBGET integrated database retrieval system