KEGG   Miniopterus natalensis: 107527421
Entry
107527421         CDS       T05883                                 

Gene name
SST
Definition
(RefSeq) somatostatin
  KO
K05237  somatostatin
Organism
mna  Miniopterus natalensis
Pathway
mna04024  cAMP signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04935  Growth hormone synthesis, secretion and action
mna04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107527421 (SST)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107527421 (SST)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    107527421 (SST)
  09154 Digestive system
   04971 Gastric acid secretion
    107527421 (SST)
SSDB
Motif
Pfam: Somatostatin
Other DBs
NCBI-GeneID: 107527421
NCBI-ProteinID: XP_016055664
LinkDB
Position
Unknown
AA seq 116 aa
MLSCRLQCALAALSIVLALGGVAAAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP
NQTENDALEPEDLSQAAEQDEMRLELQRSTNSNPAMAPRERKAGCKNFFWKTFTSC
NT seq 351 nt   +upstreamnt  +downstreamnt
atgctgtcctgccgcctccagtgcgcgctggctgcgctctccatcgtcctcgctctgggc
ggtgtcgccgccgcgccctcggacccccgactccgtcagtttctgcagaagtccctggct
gccgccgcggggaagcaggaactggccaagtacttcttggcagagctgctgtctgaaccc
aaccagacagagaatgatgccctggaacctgaagatttgtcccaggctgctgagcaggat
gaaatgaggctggagctgcagagatccactaattcaaatccggccatggcaccccgagaa
cgcaaagctggctgcaagaatttcttctggaagaccttcacatcctgctag

DBGET integrated database retrieval system