KEGG   Miniopterus natalensis: 107527501
Entry
107527501         CDS       T05883                                 

Gene name
NPY1R
Definition
(RefSeq) neuropeptide Y receptor type 1
  KO
K04204  neuropeptide Y receptor type 1
Organism
mna  Miniopterus natalensis
Pathway
mna04024  cAMP signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107527501 (NPY1R)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107527501 (NPY1R)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    107527501 (NPY1R)
G protein-coupled receptors [BR:mna04030]
 Rhodopsin family
  Peptide
   Neuropeptide Y
    107527501 (NPY1R)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx TRP Git3
Other DBs
NCBI-GeneID: 107527501
NCBI-ProteinID: XP_016055763
LinkDB
Position
Unknown
AA seq 385 aa
MNSTVFSQVGNHSIYYNFSKNNSQFLAFEIDDCHLPLAMIFTLALAYGAVIILGVTGNLA
LIIIILRQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTIMDHWVFGEAMCKLNPFVQ
CVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVAIAVIWLLAVASSLPFLIYQVLT
DEPLQNFTLDGYKDKYVCFDKFPSESHRLSYTTLLLVLQYFGPLCFIFICYFKIYMRLKR
RNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNIVFDWNHQVIAICNHNL
FFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVS
KTSLKQASPVAFKKINNNDNDLKLL
NT seq 1158 nt   +upstreamnt  +downstreamnt
atgaattcaacagtattttcccaggttggaaatcattcaatctactataatttttcaaag
aataattcccagtttttggcttttgaaattgatgattgtcatctgcccttggccatgata
tttacattagctcttgcttacggagccgtgataattcttggggtcactggaaacttggcc
ttgatcataatcatcttgagacaaaaagagatgagaaatgttaccaacatcctgattgtg
aacctttccttctcagacttgcttgttgctatcatgtgtctccccttcacctttgtctac
acgataatggaccactgggttttcggtgaggcgatgtgcaagctaaatcctttcgtgcaa
tgtgtttcgatcactgtgtccattttctctctggttctcattgctgtggaacgacatcag
ctgataatcaacccacgagggtggagaccaaataatagacacgcttacgtagctattgct
gtcatttggctccttgctgtggcttcttctttacccttcctgatctaccaagtcttgact
gatgaaccactccagaatttcacacttgatgggtacaaggacaaatacgtatgctttgat
aaatttccatcggagtctcataggttgtcttataccactctcctcttggtgctgcagtat
tttggcccactctgttttatatttatttgctactttaagatatatatgcgcttaaaaagg
agaaacaatatgatggacaagatgagagacaataagtacaggtccagtgaaaccaaaaga
atcaacatcatgctgctgtccattgtggtggcatttgcagtctgctggcttcctcttacc
atctttaacattgttttcgattggaaccatcaggtcattgctatatgcaaccataatctc
ttcttcctgctctgccacctcacagcaatgatatccacctgtgtcaaccccatattttat
ggattcctgaacaaaaatttccagagagatttgcagttcttctttaacttctgtgatttc
cggtctcgagatgatgactatgagacaatagctatgtctaccatgcacacggatgtttct
aagacttctttgaagcaagcaagcccagtcgcatttaaaaaaatcaacaacaatgataat
gatctgaaactgctgtag

DBGET integrated database retrieval system