KEGG   Miniopterus natalensis: 107527504
Entry
107527504         CDS       T05883                                 

Gene name
CTSB
Definition
(RefSeq) cathepsin B isoform X1
  KO
K01363  cathepsin B [EC:3.4.22.1]
Organism
mna  Miniopterus natalensis
Pathway
mna04140  Autophagy - animal
mna04142  Lysosome
mna04210  Apoptosis
mna04612  Antigen processing and presentation
mna04621  NOD-like receptor signaling pathway
mna04924  Renin secretion
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    107527504 (CTSB)
   04140 Autophagy - animal
    107527504 (CTSB)
  09143 Cell growth and death
   04210 Apoptosis
    107527504 (CTSB)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107527504 (CTSB)
   04612 Antigen processing and presentation
    107527504 (CTSB)
  09152 Endocrine system
   04924 Renin secretion
    107527504 (CTSB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mna01002]
    107527504 (CTSB)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mna03110]
    107527504 (CTSB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107527504 (CTSB)
   00536 Glycosaminoglycan binding proteins [BR:mna00536]
    107527504 (CTSB)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.1  cathepsin B
     107527504 (CTSB)
Peptidases and inhibitors [BR:mna01002]
 Cysteine peptidases
  Family C1: papain family
   107527504 (CTSB)
Chaperones and folding catalysts [BR:mna03110]
 Intramolecular chaperones
  Papain family
   107527504 (CTSB)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   107527504 (CTSB)
Glycosaminoglycan binding proteins [BR:mna00536]
 Heparan sulfate / Heparin
  Others
   107527504 (CTSB)
SSDB
Motif
Pfam: Peptidase_C1 Propeptide_C1 Peptidase_C1_2 KSHV_K8
Other DBs
NCBI-GeneID: 107527504
NCBI-ProteinID: XP_016055767
LinkDB
Position
Unknown
AA seq 340 aa
MWRLLATLSCLAVLTSARSRLSFQPLSDELVNYVNKRNGTWKAGHNFRNVDMSYVRTLCG
TKLGGPKLPQKALFAEDIDLPENFDAREQWPDCPTIKEIRDQGSCGSCWAFGAVEAISDR
ICILTNGHVSVEVSAEDLLTCCGFQCGDGCNGGFPSGAWNFWTKKGLVSGGLYDSHVGCR
PYSIPPCEHHVNGSRPSCTGERGDTPKCSKICEPGYTPSYKEDKHFGCQSYSVPSSEKEI
MAEIFKNGPVEAAFAVYSDFLMYKSGVYQHVTGEMVGGHAVRILGWGVENDTPYWLVGNS
WNTDWGDNGFFKILRGQDHCGIESEIVAGLPCTEQYLRRI
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgtggcggctcttggccaccctcagctgcctggcagtgctgaccagtgctcggagcagg
ctcagtttccagcccctgtcagatgagctggtcaactatgttaataagcggaacggcaca
tggaaggctggacacaacttccgcaatgtggacatgagctacgtgaggactctgtgtggc
accaaactgggtggacccaagctgccccagaaagctttgtttgctgaggacatagatctg
cctgaaaacttcgatgcccgggaacagtggccagattgcccaaccatcaaggagatcaga
gaccagggttcctgtggctcctgctgggcatttggagctgtggaagccatttctgaccgg
atctgcatcctcaccaatgggcatgtcagtgtggaggtgtctgcggaggacctgcttacc
tgctgtggcttccagtgtggggacggctgtaatgggggctttccttctggcgcttggaac
ttctggacaaagaaaggcctggtttctggtggtctctatgactcccatgtaggttgcaga
ccctactccatccctccctgtgagcaccacgtgaatggctctcggccctcatgcacaggg
gagaggggggacacccccaagtgcagcaagatctgcgagccgggctataccccatcctac
aaagaagacaaacactttggatgccagtcctacagcgtccccagtagtgagaaggagatc
atggcagagatcttcaaaaatggcccagtggaggcagccttcgccgtgtattcggacttc
ctgatgtacaagtctggtgtataccaacatgtcactggagaaatggtgggaggccatgca
gtccgcatcctgggctggggagtggagaatgacaccccctactggctggttggcaactcg
tggaacaccgactggggtgacaatggcttctttaaaatcctcagaggacaggatcactgt
ggaattgaatcggaaatcgtggctggactcccatgcactgagcagtacttgagaaggatc
taa

DBGET integrated database retrieval system