KEGG   Miniopterus natalensis: 107527504
Entry
107527504         CDS       T05883                                 

Gene name
CTSB
Definition
(RefSeq) cathepsin B isoform X1
  KO
K01363  cathepsin B [EC:3.4.22.1]
Organism
mna  Miniopterus natalensis
Pathway
mna04140  Autophagy - animal
mna04142  Lysosome
mna04210  Apoptosis
mna04612  Antigen processing and presentation
mna04621  NOD-like receptor signaling pathway
mna04924  Renin secretion
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    107527504 (CTSB)
   04140 Autophagy - animal
    107527504 (CTSB)
  09143 Cell growth and death
   04210 Apoptosis
    107527504 (CTSB)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107527504 (CTSB)
   04612 Antigen processing and presentation
    107527504 (CTSB)
  09152 Endocrine system
   04924 Renin secretion
    107527504 (CTSB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mna01002]
    107527504 (CTSB)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mna03110]
    107527504 (CTSB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107527504 (CTSB)
   00536 Glycosaminoglycan binding proteins [BR:mna00536]
    107527504 (CTSB)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.1  cathepsin B
     107527504 (CTSB)
Peptidases and inhibitors [BR:mna01002]
 Cysteine peptidases
  Family C1: papain family
   107527504 (CTSB)
Chaperones and folding catalysts [BR:mna03110]
 Intramolecular chaperones
  Papain family
   107527504 (CTSB)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   107527504 (CTSB)
Glycosaminoglycan binding proteins [BR:mna00536]
 Heparan sulfate / Heparin
  Others
   107527504 (CTSB)
SSDB
Motif
Pfam: Peptidase_C1 Propeptide_C1 Peptidase_C1_2 KSHV_K8
Other DBs
NCBI-GeneID: 107527504
NCBI-ProteinID: XP_016055767
LinkDB
Position
Unknown
AA seq 340 aa
MWRLLATLSCLAVLTSARSRLSFQPLSDELVNYVNKRNGTWKAGHNFRNVDMSYVRTLCG
TKLGGPKLPQKALFAEDIDLPENFDAREQWPDCPTIKEIRDQGSCGSCWAFGAVEAISDR
ICILTNGHVSVEVSAEDLLTCCGFQCGDGCNGGFPSGAWNFWTKKGLVSGGLYDSHVGCR
PYSIPPCEHHVNGSRPSCTGERGDTPKCSKICEPGYTPSYKEDKHFGCQSYSVPSSEKEI
MAEIFKNGPVEAAFAVYSDFLMYKSGVYQHVTGEMVGGHAVRILGWGVENDTPYWLVGNS
WNTDWGDNGFFKILRGQDHCGIESEIVAGLPCTEQYLRRI
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgtggcggctcttggccaccctcagctgcctggcagtgctgaccagtgctcggagcagg
ctcagtttccagcccctgtcagatgagctggtcaactatgttaataagcggaacggcaca
tggaaggctggacacaacttccgcaatgtggacatgagctacgtgaggactctgtgtggc
accaaactgggtggacccaagctgccccagaaagctttgtttgctgaggacatagatctg
cctgaaaacttcgatgcccgggaacagtggccagattgcccaaccatcaaggagatcaga
gaccagggttcctgtggctcctgctgggcatttggagctgtggaagccatttctgaccgg
atctgcatcctcaccaatgggcatgtcagtgtggaggtgtctgcggaggacctgcttacc
tgctgtggcttccagtgtggggacggctgtaatgggggctttccttctggcgcttggaac
ttctggacaaagaaaggcctggtttctggtggtctctatgactcccatgtaggttgcaga
ccctactccatccctccctgtgagcaccacgtgaatggctctcggccctcatgcacaggg
gagaggggggacacccccaagtgcagcaagatctgcgagccgggctataccccatcctac
aaagaagacaaacactttggatgccagtcctacagcgtccccagtagtgagaaggagatc
atggcagagatcttcaaaaatggcccagtggaggcagccttcgccgtgtattcggacttc
ctgatgtacaagtctggtgtataccaacatgtcactggagaaatggtgggaggccatgca
gtccgcatcctgggctggggagtggagaatgacaccccctactggctggttggcaactcg
tggaacaccgactggggtgacaatggcttctttaaaatcctcagaggacaggatcactgt
ggaattgaatcggaaatcgtggctggactcccatgcactgagcagtacttgagaaggatc
taa

KEGG   Miniopterus natalensis: 107539106
Entry
107539106         CDS       T05883                                 

Gene name
CTSS
Definition
(RefSeq) cathepsin S
  KO
K01368  cathepsin S [EC:3.4.22.27]
Organism
mna  Miniopterus natalensis
Pathway
mna04142  Lysosome
mna04145  Phagosome
mna04210  Apoptosis
mna04612  Antigen processing and presentation
mna05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107539106 (CTSS)
   04142 Lysosome
    107539106 (CTSS)
  09143 Cell growth and death
   04210 Apoptosis
    107539106 (CTSS)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    107539106 (CTSS)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107539106 (CTSS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mna01002]
    107539106 (CTSS)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mna03110]
    107539106 (CTSS)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.27  cathepsin S
     107539106 (CTSS)
Peptidases and inhibitors [BR:mna01002]
 Cysteine peptidases
  Family C1: papain family
   107539106 (CTSS)
Chaperones and folding catalysts [BR:mna03110]
 Intramolecular chaperones
  Papain family
   107539106 (CTSS)
SSDB
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2
Other DBs
NCBI-GeneID: 107539106
NCBI-ProteinID: XP_016070977
LinkDB
Position
Unknown
AA seq 342 aa
MGAPAGSIIMQWLLWVLLGCSSAMAMAQLHKDPTLDRHWDLWKQTYGKQYTEKNEEVARR
LIWEKNLKFVMLHNLEHSMGMHSFDLGMNHLADMTSEEVVFLMSSLRVPNQWPRNVTYKS
NPNQKLPDSLDWRDKGCVTEVKNQGSCGSCWAFSAVGALEAQLKLKTGKLVSLSAQNLVD
CSTEKYSNKGCNGGFMTRAFQYIIDNNGIESEASYPYKATDGKCQYDSKYRAATCSKYIE
LPFGSEDALKEAVANKGPVSVAIDTNHPSFFLYKSGVYYEPACTLNVNHAVLVVGYGNRD
GKDYWLVKNSWGLYFGEQGYILMARNRGNHCGIANYPSYPEI
NT seq 1029 nt   +upstreamnt  +downstreamnt
atgggagcacctgctggttccattataatgcaatggctgctttgggttctcctggggtgc
tcctctgcaatggcgatggcacagctgcacaaagatcccacgctggaccgtcactgggat
ctctggaagcaaacttatggcaagcaatacacagaaaagaatgaggaagtagcacgacgt
ctcatctgggaaaagaatctaaaatttgtgatgcttcacaacctggagcattcaatggga
atgcattcattcgatctaggcatgaaccacctggcagatatgaccagtgaagaagtggtg
tttttgatgagttccctgagagttcccaaccaatggccaagaaacgtcacttacaagtca
aaccctaatcaaaaattacctgattctctggactggagagacaaggggtgtgttaccgaa
gtgaaaaaccagggttcttgtggttcttgttgggctttcagtgctgtgggggccctggaa
gcacagctgaagctgaagacaggaaagctggtgtctctgagtgcacagaacctggtggac
tgctcgactgaaaaatacagcaataaaggctgcaatggtggattcatgacacgggctttc
caatatatcattgacaacaatggcatcgaatcagaagcttcctatccctacaaagccacg
gatgggaagtgccaatatgactcaaaatatcgagctgccacgtgttcaaagtatattgaa
cttccctttggcagtgaagatgccttgaaagaagctgtggccaataaaggacctgtgtct
gttgctatagatacgaaccatccttctttcttcctctacaaaagtggtgtctactatgaa
ccagcctgtactctaaatgtgaatcatgctgtattagtggttggctatggtaaccgtgat
gggaaagactactggcttgtgaaaaacagctggggcctctactttggtgaacaaggatat
attctgatggcaagaaatagaggaaatcattgtgggattgctaattatccctcttacccg
gaaatctag

KEGG   Miniopterus natalensis: 107543082
Entry
107543082         CDS       T05883                                 

Definition
(RefSeq) cathepsin L1
  KO
K01365  cathepsin L [EC:3.4.22.15]
Organism
mna  Miniopterus natalensis
Pathway
mna04140  Autophagy - animal
mna04142  Lysosome
mna04145  Phagosome
mna04210  Apoptosis
mna04612  Antigen processing and presentation
mna05205  Proteoglycans in cancer
mna05323  Rheumatoid arthritis
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107543082
   04142 Lysosome
    107543082
   04140 Autophagy - animal
    107543082
  09143 Cell growth and death
   04210 Apoptosis
    107543082
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    107543082
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107543082
  09163 Immune disease
   05323 Rheumatoid arthritis
    107543082
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107543082
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mna01002]
    107543082
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mna03110]
    107543082
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mna00537]
    107543082
Enzymes [BR:mna01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.15  cathepsin L
     107543082
Peptidases and inhibitors [BR:mna01002]
 Cysteine peptidases
  Family C1: papain family
   107543082
Chaperones and folding catalysts [BR:mna03110]
 Intramolecular chaperones
  Papain family
   107543082
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mna00537]
 Others
  107543082
SSDB
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2 Styelin DUF5438
Other DBs
NCBI-GeneID: 107543082
NCBI-ProteinID: XP_016075976
LinkDB
Position
Unknown
AA seq 334 aa
MTPSLLLAALCLGIASATPRLDPSLDASWYQWKATHRRLYGVNEEGWRRAVWEKNMKMIE
LHNREYSQRKHGFTMAMNAYGDMTNEEFRQVMNGFQSQKHRKGKVFREPLFASVPPSVDW
RDKGYVTPVKNQGQCGSCWAFSATGALEGQMFRKTGKLVSLSEQNLVDCSHSQGNEGCNG
GLMDNAFQYVKDNKGLDSEESYPYLGRESDTCNYKPEYSAANDTGFVDIPQRERSLMKAV
ATVGPISVAIDAGHSSFQFYNAGIYYEPNCSSKDLDHGVLVVGYGSEGGESNSNKFWIVK
NSWGSGWGMNGYVKMARDQNNHCGIATAASYPTV
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgactccttcactcctcctggctgccctctgcttggggatagcctcagctactccaaga
cttgatcccagtttggatgcatcatggtaccagtggaaggcaacgcacaggagactatat
ggcgtgaatgaagaagggtggaggagagcagtgtgggaaaagaatatgaaaatgattgaa
ctgcataaccgggagtacagccaaaggaaacatggcttcaccatggcgatgaacgcctat
ggggacatgaccaatgaagaattcaggcaggtgatgaacggttttcaaagccagaagcac
aggaaggggaaagtgttccgagaacctctctttgcttcagtacccccatctgtggattgg
agagacaaaggctatgtaactcctgtgaagaatcagggtcaatgcggttcttgttgggct
tttagtgcaactggtgcccttgaaggacagatgttccgtaaaactggcaaacttgtttct
ctgagcgagcagaacctggtggactgctctcactctcagggcaatgagggctgcaatggt
gggctaatggataatgccttccagtatgtcaaggacaacaaaggcctggactcagaggaa
tcctatccatatcttggaagggaatcagatacctgtaactacaaacctgagtattctgct
gccaatgacaccggctttgtggatatcccgcagcgtgagaggtcccttatgaaggcagtg
gcaactgtggggcccatctctgttgctatagatgcaggccattcatcgttccagttctat
aatgcaggcatatattatgaaccaaactgcagcagcaaagacctggaccacggtgtcctg
gtggttggctatggctctgaagggggagaatcaaacagcaataaattttggattgtcaag
aacagctggggttcaggatggggcatgaatggctacgtaaaaatggccagagaccagaac
aaccactgtggaatcgccacagcagccagctatcccactgtgtga

KEGG   Miniopterus natalensis: 107544923
Entry
107544923         CDS       T05883                                 

Gene name
CTSL
Definition
(RefSeq) cathepsin L1
  KO
K01365  cathepsin L [EC:3.4.22.15]
Organism
mna  Miniopterus natalensis
Pathway
mna04140  Autophagy - animal
mna04142  Lysosome
mna04145  Phagosome
mna04210  Apoptosis
mna04612  Antigen processing and presentation
mna05205  Proteoglycans in cancer
mna05323  Rheumatoid arthritis
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107544923 (CTSL)
   04142 Lysosome
    107544923 (CTSL)
   04140 Autophagy - animal
    107544923 (CTSL)
  09143 Cell growth and death
   04210 Apoptosis
    107544923 (CTSL)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    107544923 (CTSL)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107544923 (CTSL)
  09163 Immune disease
   05323 Rheumatoid arthritis
    107544923 (CTSL)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107544923 (CTSL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mna01002]
    107544923 (CTSL)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mna03110]
    107544923 (CTSL)
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mna00537]
    107544923 (CTSL)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.15  cathepsin L
     107544923 (CTSL)
Peptidases and inhibitors [BR:mna01002]
 Cysteine peptidases
  Family C1: papain family
   107544923 (CTSL)
Chaperones and folding catalysts [BR:mna03110]
 Intramolecular chaperones
  Papain family
   107544923 (CTSL)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mna00537]
 Others
  107544923 (CTSL)
SSDB
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2 Styelin
Other DBs
NCBI-GeneID: 107544923
NCBI-ProteinID: XP_016078356
LinkDB
Position
Unknown
AA seq 330 aa
MNPSFFLTTFYLGIASAAPKLDGSLDAQWNQWKATHRKLYDLNEGWRRAVWEKNMKVIDL
HNREYNLGKQGFTMAMNAFGDMTNEEFRQVMNGLQYQKHKKRKVFREPLLADMPPTVDWR
EEGYVTPVKNQGHCGSCWAFSATGALEGQMFRKTGKLISLSEQNLVDCSQAQGNMGCRGG
LMDNAFRYVQSNGGLDSEESYPYQAMVGSCKYRPEDSVANDTGFVDIPQQEMSLMKAVAT
VGPISVAVDASHISFQFYEDGIYYDPHCSSENLDHGVLVVGYGFEGELNNKYWIVKNSWG
RAWGRNGYIKMAKDRDNHCGIATAASYPTV
NT seq 993 nt   +upstreamnt  +downstreamnt
atgaatccttcattcttcttgactaccttttacttaggaatagcttcagctgctccaaaa
cttgatgggagtttagatgcgcaatggaaccagtggaaggcgacacacagaaaactatat
gacttgaacgaaggatggaggagagcagtgtgggagaagaacatgaaagtgatcgacctg
cacaaccgggagtacaacctggggaagcagggcttcaccatggcgatgaatgcctttggg
gacatgaccaacgaagaattcaggcaggtgatgaatggccttcaataccagaagcacaag
aaaaggaaagtgttccgggaacctctccttgccgacatgcccccaactgtggactggagg
gaggaaggctatgtaactcctgtgaagaatcagggtcactgcggttcttgttgggctttt
agtgcaactggtgcccttgaaggacagatgttccggaaaactggcaaacttatttcactg
agtgagcagaaccttgtggactgctctcaggctcaaggcaatatgggctgccgtggtggc
ctaatggataatgccttccggtacgttcagtccaacggaggcctggactcagaggaatcc
tacccatatcaggcaatggttggatcctgtaaatacaggcctgaggattctgttgccaat
gacactggcttcgtggacatccctcagcaagagatgtccctcatgaaggcagtggcaact
gtcgggcccatctctgttgctgtagatgcaagccacattagcttccagttctatgaagat
ggcatttattatgatccacactgcagcagcgaaaacctagatcatggtgtcctggtggtt
ggctatggctttgaaggagaattgaataataaatattggattgtcaagaacagttggggt
agagcttggggcaggaatggctacataaagatggccaaagaccgggacaaccactgtgga
atcgctacggcggccagctatcctactgtgtga

DBGET integrated database retrieval system