KEGG   Miniopterus natalensis: 107527534
Entry
107527534         CDS       T05883                                 

Gene name
GUCY1A3
Definition
(RefSeq) guanylate cyclase soluble subunit alpha-3
  KO
K12318  guanylate cyclase soluble subunit alpha [EC:4.6.1.2]
Organism
mna  Miniopterus natalensis
Pathway
mna00230  Purine metabolism
mna01100  Metabolic pathways
mna04022  cGMP-PKG signaling pathway
mna04270  Vascular smooth muscle contraction
mna04540  Gap junction
mna04611  Platelet activation
mna04713  Circadian entrainment
mna04730  Long-term depression
mna04921  Oxytocin signaling pathway
mna04924  Renin secretion
mna04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107527534 (GUCY1A3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    107527534 (GUCY1A3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107527534 (GUCY1A3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107527534 (GUCY1A3)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107527534 (GUCY1A3)
   04924 Renin secretion
    107527534 (GUCY1A3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107527534 (GUCY1A3)
  09154 Digestive system
   04970 Salivary secretion
    107527534 (GUCY1A3)
  09156 Nervous system
   04730 Long-term depression
    107527534 (GUCY1A3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107527534 (GUCY1A3)
Enzymes [BR:mna01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     107527534 (GUCY1A3)
SSDB
Motif
Pfam: Guanylate_cyc HNOBA HNOB
Other DBs
NCBI-GeneID: 107527534
NCBI-ProteinID: XP_016055797
LinkDB
Position
Unknown
AA seq 689 aa
MFCTKLKDLNITGECPFSLLAPGQVPKEPAEEVAGSSESCKATLPICQDVPEKKVQGSLP
QRKTSRSRVYLHTLAESICKLIFPEFERLNLALQRTLAKHKIKESRKSVEREDFEKMIAD
QALAAGVPAEVIKASLGEEIFKICYEEDEHILGVVGGTLKDFLNSFSTLLKQSSHCQEAE
KGRLEAASILCLDKDHDFLNVYYFFPKKITSLILPGVIKAAAHILYETEVEVSLMPSCFC
SDGSEFVNQPYALYSVHVKSTKPSLSPGKPQSSLVIPASLFCKTFPFHFMFDKDMTILQF
GNGIRRLMNRRDLQGKPNFEEYFEILTPKINQTFSGIMTMLNLQFVLRVRRWDNSVKKSS
RVMDLKGQMIYIIESNAILFLGSPCVDRLEDFTGRGLYLSDIPIHNALRDVVLIGEQARA
QDGLKKRLGKLKATLEQAHQALEEEKKKTVDLLCSIFPSEVAQQLWQGQVVQAKKFSNVT
MLFSDIVGFTAICSQCSPLQVITMLNALYTRFDQQCGELDVYKVETIGDAYCVAGGLHKE
SDTHAVQIALMALKMMELSDEVMSPHGEPIKMRIGLHSGSVFAGVVGVKMPRYCLFGNNV
TLANKFESCSVPRKINVSPTTYRLLKDCPGFVFTPRSREELPPNFPSEIPGICHFLEAYQ
QGTNSKPWFQKQDVEDGNANFLGKASGVD
NT seq 2070 nt   +upstreamnt  +downstreamnt
atgttctgtacgaagctgaaggatctcaatatcacaggggagtgtcctttctccttactg
gcaccagggcaggttcctaaagagccagcagaggaggtggcaggaagctcagagagctgc
aaagccacgctgcccatctgtcaggacgttcctgagaagaaggtacaaggaagtctccct
caaagaaagaccagtcggagccgagtatatcttcacactttggcagagagcatttgcaaa
ttgattttccccgagtttgaacgactgaaccttgcacttcagagaacactggcaaaacac
aaaataaaagaaagcagaaaatctgtggaaagagaagactttgaaaaaatgattgcagac
caagcacttgcagcaggagttccagcggaggtcatcaaagcatctctcggtgaagagatt
tttaaaatatgttatgaggaagatgaacacatcctgggtgtggtgggaggaaccctcaaa
gattttttaaatagcttcagcacccttctgaagcagagcagccactgccaagaagcagag
aagggccggctggaggcggcctccattctctgcctcgataaggatcacgatttcttaaac
gtttattatttcttccccaagaagatcacatctctgattcttcccggcgtcattaaggcg
gctgctcacatcttgtacgaaaccgaggtggaagtgtcactgatgccctcctgcttctgc
agcgatggcagcgagtttgttaaccagccttatgccttatactccgttcatgtcaaaagc
accaaaccgtccctgtccccaggcaaaccccagtcctcgctggtcatccctgcttctctc
ttctgcaagacatttccgttccatttcatgtttgacaaagacatgacgattctgcaattt
ggcaacggcatcaggaggctgatgaacaggagggacttgcaaggaaagcctaattttgaa
gagtactttgaaattctgactccgaaaatcaaccagacatttagcggaatcatgactatg
ttgaatttgcaatttgtgctccgagtgaggagatgggacaactctgtgaagaaatcttca
agggttatggacctcaaaggccaaatgatctacatcattgaatccaatgcaatcttgttc
ttgggctcaccctgtgtggacagattagaagattttacaggacgagggctctacctctct
gacatcccaattcacaatgcgctaagggatgtggtcttgataggagaacaggccagagct
caagatggccttaagaagaggctgggaaaactgaaagccactcttgagcaagcccaccag
gctctggaggaagagaagaagaagacagttgatcttctgtgctctatatttccctccgag
gtggcacagcagctgtggcaagggcaagtcgtgcaagccaagaagttcagtaacgtcacc
atgcttttctcagacattgttgggttcactgccatctgctcccagtgctcgccgctgcag
gtcatcaccatgctcaatgcgctctacacacgctttgaccagcagtgtggagagctggat
gtctacaaggtggagaccattggtgatgcatattgtgtggctgggggattacacaaagaa
agtgatacccatgctgttcagatagcgctgatggccctgaagatgatggagctctctgat
gaagtcatgtctcctcatggagagcctatcaagatgcgaatcggactgcattctgggtcg
gtttttgctggagttgttggagttaagatgcctcgttactgtctttttggaaacaatgtc
accttggctaacaaatttgagtcctgcagtgtaccacggaaaatcaatgtcagcccaaca
acttacagattactcaaagactgtcccggttttgtgtttacccctcgatcaagggaagaa
cttccaccaaacttccccagtgaaattcctggaatctgtcattttctggaagcgtatcaa
caaggaacaaattcaaaaccatggttccaaaagcaagatgttgaagatggcaatgccaat
tttctaggcaaagcatcaggagtagattag

KEGG   Miniopterus natalensis: 107527535
Entry
107527535         CDS       T05883                                 

Gene name
GUCY1B3
Definition
(RefSeq) guanylate cyclase soluble subunit beta-1
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
mna  Miniopterus natalensis
Pathway
mna00230  Purine metabolism
mna01100  Metabolic pathways
mna04022  cGMP-PKG signaling pathway
mna04270  Vascular smooth muscle contraction
mna04540  Gap junction
mna04611  Platelet activation
mna04713  Circadian entrainment
mna04730  Long-term depression
mna04921  Oxytocin signaling pathway
mna04924  Renin secretion
mna04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107527535 (GUCY1B3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    107527535 (GUCY1B3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107527535 (GUCY1B3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107527535 (GUCY1B3)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107527535 (GUCY1B3)
   04924 Renin secretion
    107527535 (GUCY1B3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107527535 (GUCY1B3)
  09154 Digestive system
   04970 Salivary secretion
    107527535 (GUCY1B3)
  09156 Nervous system
   04730 Long-term depression
    107527535 (GUCY1B3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107527535 (GUCY1B3)
Enzymes [BR:mna01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     107527535 (GUCY1B3)
SSDB
Motif
Pfam: Guanylate_cyc HNOBA HNOB 4_1_CTD
Other DBs
NCBI-GeneID: 107527535
NCBI-ProteinID: XP_016055798
LinkDB
Position
Unknown
AA seq 551 aa
MFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDAEKG
KGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQRNEECDHTQFLIEEKESKE
EDFYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDRDLVVTQCGNAIYRVLPQLQPGNC
SLLSVFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDELTGTEISCLRLKG
QMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQE
LEILTDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPVPAKRYDNVTILFSGIV
GFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLPEP
CIHHARSICHLALDMMEIAGQVQVDGESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVN
LTSRTETTGEKGKINVSEYTYRCLMTPENSDPQFHLEHRGPVSMKGKKEPMQVWFLSRKN
TGTEETNQDGN
NT seq 1656 nt   +upstreamnt  +downstreamnt
atgtttgggaagatgttttttgtcttttgtcaagaatccggttatgatacaatcttgcgc
gtcctgggatctaatgtcagagaattcctacagaacctggatgctctgcatgaccacctt
gctactatctacccagggatgcgtgcgccttcctttaggtgcacagatgcagagaagggc
aaaggactcattctgcactactactcagagagggaagggcttcaggatattgtcattgga
atcattaaaacggtcgctcaacaaatccatggcacagaaatcgacatgaaggttattcag
caaagaaacgaagaatgtgatcatactcagtttttaattgaagaaaaagagtcgaaggaa
gaggatttctatgaagatctggacagatttgaagaaaatggtacccaggaatcacgcatc
agcccctacaccttctgcaaagcttttccttttcacatcatatttgaccgggacctagtg
gtcacccagtgtggcaatgccatatacagagtgcttccccagctccagcctggcaattgc
agccttttgtctgtcttctctctggttcgtcctcatattgacattagtttccatgggatc
ctttcacacattaatacagttttcgtattgagaagcaaggaaggattgttggatgtagag
aaattagaatgtgaagatgaactgacggggactgagatcagctgcttacgtctcaaaggt
caaatgatctacttacctgaagcagatagcatactttttctgtgttcaccaagtgtgatg
aatctggacgatttgacaaggagaggcctgtatctcagtgacatccctctgcacgatgcc
acacgtgaccttgttcttttgggagaacaattcagagaggagtacaaactgacccaggaa
ctggaaatcctgacggacagactgcagctcaccttacgggcactggaagatgaaaagaaa
aagacagacacgctgctatactctgtccttcctccatccgtcgccaatgagctgagacac
aagcgtcccgttcctgctaaaagatatgacaatgtgaccatcctcttcagtggcattgtg
ggcttcaatgctttctgtagcaagcatgcatctggggaaggggccatgaagattgtcaac
cttctcaacgacctctacaccagatttgacacactgactgattcccggaaaaatccattt
gtgtataaggtggagactgttggtgataagtacatgaccgtgagcggcttaccagagccc
tgcatccaccatgcacgatccatttgccacctggccttggacatgatggaaattgctggc
caggttcaagtagatggtgaatctgttcagataacaatagggatacacactggcgaggta
gtcacgggggtcataggacagcggatgcctcgttactgtcttttcgggaatactgtcaac
ctcacaagcagaacagaaaccactggagaaaaaggaaaaataaatgtgtctgaatataca
tacagatgtcttatgacaccagaaaattcagatccgcagttccatttggagcacagaggc
ccagtgtccatgaagggcaaaaaagaaccaatgcaagtttggtttctatccagaaaaaac
acagggacagaggaaacaaaccaggatggtaactga

KEGG   Miniopterus natalensis: 107532921
Entry
107532921         CDS       T05883                                 

Gene name
GUCY1A2
Definition
(RefSeq) guanylate cyclase soluble subunit alpha-2
  KO
K12318  guanylate cyclase soluble subunit alpha [EC:4.6.1.2]
Organism
mna  Miniopterus natalensis
Pathway
mna00230  Purine metabolism
mna01100  Metabolic pathways
mna04022  cGMP-PKG signaling pathway
mna04270  Vascular smooth muscle contraction
mna04540  Gap junction
mna04611  Platelet activation
mna04713  Circadian entrainment
mna04730  Long-term depression
mna04921  Oxytocin signaling pathway
mna04924  Renin secretion
mna04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107532921 (GUCY1A2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    107532921 (GUCY1A2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107532921 (GUCY1A2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107532921 (GUCY1A2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107532921 (GUCY1A2)
   04924 Renin secretion
    107532921 (GUCY1A2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107532921 (GUCY1A2)
  09154 Digestive system
   04970 Salivary secretion
    107532921 (GUCY1A2)
  09156 Nervous system
   04730 Long-term depression
    107532921 (GUCY1A2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107532921 (GUCY1A2)
Enzymes [BR:mna01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     107532921 (GUCY1A2)
SSDB
Motif
Pfam: Guanylate_cyc HNOBA Rx_N
Other DBs
NCBI-GeneID: 107532921
NCBI-ProteinID: XP_016062940
LinkDB
Position
Unknown
AA seq 497 aa
MLHYFHPHHIVGFAMLGMIKAAGKKIYRLDVEVEQVANEKLCSDGSNPSNCSCLTFLIKE
CENTNITKNLPQGTSQVPEDLRISINTFCRAFPFHLMFDPHMAVLQLGEGLRKQLRCDTH
KVLKFEDCFQIVSPKVNATFERVLLRLSTPFVIRTKPEASGTENKDKVMEVKGQMIHVPE
SNSILFLGSPCVDKLDELMGRGLHLSDIPIHDATRDVILVGEQAKAQDGLKKRMDKLKAT
LERTHQALEEEKKKTVDLLYSIFPGDVAQQLWQGQQVQARKFDDVTMLFSDIVGFTAVCA
QCTPMQVISMLNELYTRFDHQCGFLDIYKVETIGDAYCVAAGLHRKSLCHAKPIALMALK
MMELSEEVLTPDGRPIQMRIGIHSGSVLAGVVGVRMPRYCLFGNNVTLASKFESGSHPRR
INVSPTTYQLLKREESFTFIPRSREELPDNFPKEIPGICYFLEVRTGPKQPKSSLSSSRI
KKVSYNIGTMFLRETSL
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgctccactacttccaccctcaccatattgtgggctttgcgatgctgggcatgatcaag
gcggctggaaagaagatctatcggctggatgtggaagtggagcaggttgcaaatgagaaa
ctgtgctctgatggctccaacccaagcaactgtagctgtcttaccttcctcatcaaagaa
tgtgaaaatactaatatcacaaagaacctcccacagggaacctcccaagttcccgaggac
ctcagaattagcatcaacaccttctgcagagccttccccttccacttgatgtttgacccc
cacatggcagtccttcagctgggggaaggcctgaggaagcagctccgatgcgacactcac
aaagtgctcaagtttgaggactgcttccagatcgtttccccgaaggtaaacgccaccttc
gaaagggtcctactgcgactgtccaccccatttgtgattaggaccaagccggaggcttct
ggcactgaaaataaagacaaggtgatggaagtcaaaggacaaatgattcatgtcccagaa
tcaaattccattttattcttgggctccccatgtgtggacaagctggatgaactcatgggc
cggggactgcatctctcagacatccccatccatgatgccacccgagatgtcattttggtt
ggtgagcaggcaaaggcccaagatggcttgaagaagagaatggataaattaaaggcgact
ttagaaagaactcaccaggccctggaagaagagaaaaagaaaacagtggatcttctgtat
tctattttccctggcgatgtagcccagcagctgtggcaggggcagcaagtgcaggccagg
aagtttgacgacgtcaccatgctcttttcggacatcgttggcttcacggccgtctgcgct
cagtgcacccccatgcaggtgatcagcatgctgaatgagctgtacaccagattcgatcac
cagtgtggatttttggatatttataaggtggaaacaataggtgacgcgtactgtgttgct
gcaggactccacagaaaaagcctctgccatgctaagcccattgctctcatggccctgaag
atgatggaactttcagaagaggtactgacgcctgacggaagaccaattcagatgaggata
ggcattcattcaggctccgtgctggccggagtggttggggtgagaatgccacgatattgc
ctctttggaaataatgtcaccctggcaagcaaattcgaatcggggagccaccctcggcgc
atcaacgtcagccccaccacttaccagttattaaaacgggaagaaagtttcacattcatc
cctcggtcccgtgaagagcttcccgacaactttccaaaggaaatccccgggatctgctat
ttcctggaggtaaggactggtccgaagcagccaaagtcttctctgtcttcatcgaggata
aaaaaggtttcctacaacattggcaccatgttcctccgggagaccagcctctga

KEGG   Miniopterus natalensis: 107537733
Entry
107537733         CDS       T05883                                 

Definition
(RefSeq) guanylate cyclase soluble subunit beta-2-like
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
mna  Miniopterus natalensis
Pathway
mna00230  Purine metabolism
mna01100  Metabolic pathways
mna04022  cGMP-PKG signaling pathway
mna04270  Vascular smooth muscle contraction
mna04540  Gap junction
mna04611  Platelet activation
mna04713  Circadian entrainment
mna04730  Long-term depression
mna04921  Oxytocin signaling pathway
mna04924  Renin secretion
mna04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107537733
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    107537733
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107537733
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107537733
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107537733
   04924 Renin secretion
    107537733
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107537733
  09154 Digestive system
   04970 Salivary secretion
    107537733
  09156 Nervous system
   04730 Long-term depression
    107537733
  09159 Environmental adaptation
   04713 Circadian entrainment
    107537733
Enzymes [BR:mna01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     107537733
SSDB
Motif
Pfam: Guanylate_cyc HNOB HNOBA
Other DBs
NCBI-GeneID: 107537733
NCBI-ProteinID: XP_016069313
LinkDB
Position
Unknown
AA seq 1129 aa
MPPWEVIRPSPDFVLEGVGMPGHVPSQQLTEAFMQKVVVRIPESSGLHNGLLSGDGREVL
LPRAVYGVLVTGYKRPPCERPPARAPAPTLAAGIPQTRGPGRQVAEACELAPPPPPDQVA
QRRPLDGAHGEKSSTMFRKLHSVFNPSPQRKAEAAGGSCFHRAGPTVRLIRSSSMYVVGD
HGEKFSESLKKYKSTSSMDTSLYYLQQEGDRAWMYSRTQDCLQYLQELLALRKKYLSSLN
DLKPKRAQGFSSTSSKSSKGGKKALGQSTSKETKKATPKKYSQFSADVAEAIAFFDSIIA
ELDTEKKPRAAEADLQNEDVDFDVATSSREHSLHSNWILRVPRRHSEDMAVRTIHTTDGQ
FRKSTERRTIGTQRRLERHPIYLPKAVEGAFSTLKFKPKACKKDLGSSRRILFNFSGEDM
EWDAELFALEPLASSGEDYFETENPKGQWLLRERLWERTYGFINTCLQSLVIEKFGEETW
EKLKASAGVQDAFMMYTVYDDIITLKLIQEACKILDVSMEAILKLFGEYFFKFCKKSGYD
RMLRTLGGDLTEFIENLDALHSYLALSYQEMNAPSFRLERGADKKMLLHYYSDRSGLCHI
VPGIIEAVAKDFFNMDVSMDVLDMNKEEERTGKKEHVVFLIVQKPHRQVRRTKLNRLQDG
QDIQRDQEALKAALVRKKEKYLSVSVCPVKKSHWEVVRSIVMFGKGHLLNTFVPIYPERL
WIEVKTFCNAFPFHIVFDESLRVKQMGVNIQKYIPGLQTQKIRLDEYFSIVHPQVTFNIS
SICKFINSQFVLKARREMMPEAWKSQPTLKLRGQMIWMESMWCMIYLCSPKLRSLQELEE
RQMHLSDLAPHDTTRDLILLNQQRLAEIELSTQLERKKEELRVLSKHLAMEKKKTETLLY
AMLPEHVANQLKEGKKVAAGEFKTCTILFSDVVTFTNICAACEPLQIVNMLNSMYSKFDR
LTSVHEVYKVETIGDAYMVVGGVPVPIGSHAQRVANFALGMRISAKEVMNPVTGEPIQIR
VGIHTGPVLAGVVGDKMPRYCLFGDTVNTASRMESHGLPNKVHLSPTAYRALENQGFEII
ERGEIQVKGKGKMTTYFLIQNLNASEDEIMGRPQTLFDHKGKPRREASL
NT seq 3390 nt   +upstreamnt  +downstreamnt
atgccaccatgggaagtaattaggccctcacctgacttcgtgctggaaggggttggaatg
cctggccatgtgccctctcagcagctgactgaagcttttatgcagaaagttgtggtccgg
atacctgagtcctccgggctccacaatgggctgctatctggtgacggccgtgaggttttg
ttaccacgggcggtttacggcgttctggttactgggtataagcggcccccatgcgagagg
ccgcccgcccgcgcgcccgcgcccacgctcgccgccgggatcccacagaccagaggcccc
gggaggcaggtggccgaggcctgtgagctggctcctccgcccccgccagatcaggtggcg
cagcgcaggccgctggacggcgcccacggagagaaatccagcaccatgttcagaaagctg
cactccgtgtttaaccccagcccgcagaggaaggcggaggcggcgggcggttcctgcttc
caccgagccggccccacggtgcggctcatccgcagcagctccatgtacgtggttggggac
cacggggagaagttcagtgagtccttgaagaagtacaaaagcaccagcagcatggacacc
agcctgtactacctgcagcaggagggcgaccgggcctggatgtactcacgcacccaggac
tgtctgcagtacctgcaggagctgctggccttgcggaaaaaatacctgagcagcctcaac
gacctgaagcccaagcgtgcccagggcttctcctccacctcgtccaaatcctccaaggga
ggaaaaaaggcccttggtcagtccacctccaaagaaacaaagaaagcaacccccaagaaa
tactcgcagtttagcgcagatgtggcagaggccatcgccttctttgactccatcatcgca
gagctggatacagagaaaaagccccgggctgctgaggcagacctccagaatgaagacgtg
gactttgatgtggccaccagctcccgggagcacagcttgcactccaactggatcctgagg
gtgccgcgccgacactctgaagacatggctgtacgtaccatacacacgacagacggccag
tttcgaaaaagcacagagcgcaggaccattggcactcagaggagacttgagaggcacccc
atttacttgcccaaggctgtggaaggggcattcagcaccttgaaatttaagcccaaagcc
tgcaaaaaagacctggggagctccagacggatcctcttcaacttctccggagaagacatg
gaatgggatgcggagctctttgcactggagccactggcatcttctggggaggactacttc
gaaacagaaaaccccaaaggacagtggctgcttcgagaacgactctgggagcggacatat
ggatttatcaacacctgtctgcaatctcttgtaatagagaaatttggtgaagagacatgg
gaaaagttgaaagcttctgctggagtgcaggatgccttcatgatgtatacagtgtatgac
gacatcattacccttaagctcatccaagaggcctgcaagattctggatgtctccatggaa
gccattctgaagctctttggagaatacttctttaaattctgtaagaagtctggctatgac
cggatgttacgaacactgggaggagatctcacggagtttattgaaaacctagatgccctc
cacagttaccttgcactttcttaccaggagatgaatgcaccatcatttcgtttggagaga
ggagcagacaagaaaatgcttctccattactactctgatagaagtggtctgtgccacatt
gtaccaggcatcattgaggctgtggccaaagacttcttcaacatggacgtgtccatggat
gttcttgacatgaataaggaagaggagaggacagggaagaaggagcacgttgtgtttctg
attgtgcagaagcctcacagacaggtgagaaggacaaagctaaacaggctacaggatggt
caggacattcagagagaccaagaggccctcaaggcagctttggtaaggaagaaggagaaa
tatttgagtgtctctgtttgtcctgtgaagaaatctcactgggaagttgtgagaagtata
gtcatgtttggaaaagggcatctcctgaacacctttgtgccgatttatcccgagcggctc
tggattgaagttaagacattttgcaatgcttttcctttccacattgtatttgatgaatca
ctgagggtcaagcaaatgggagtgaatattcagaagtatatcccaggactccaaacccag
aagattcgattagatgagtatttctccatcgttcatcctcaagttaccttcaacatttcc
agcatctgcaaatttatcaacagtcaatttgtcctgaaggcacggagagaaatgatgcct
gaagcatggaaaagtcaacccacactcaaactccgaggccagatgatctggatggagtcc
atgtggtgcatgatatacctgtgctccccaaagctccgtagcctgcaagagctggaggag
cgccagatgcatctttctgacctcgccccccatgacaccaccagggatctcattttgctg
aaccagcagcgactggctgagattgagctgtccacccagttggagaggaagaaggaggag
ctgcgggtcctatctaaacacctggccatggaaaagaagaaaaccgagaccttgctttat
gccatgctgcccgaacatgtggccaaccagctgaaggaaggcaaaaaggtggctgcagga
gaatttaaaacctgcacaatcctttttagtgatgtggtgacatttacaaacatctgtgct
gcctgtgaacctctccaaatagtgaatatgcttaattcaatgtactccaagtttgacaga
ttgaccagtgtccatgaagtctacaaagtggaaacaataggagatgcttacatggtggta
gggggtgtgccagtgcctattggaagccatgctcaaagagtggctaattttgccttgggg
atgagaatttctgcaaaagaagtaatgaatcctgttaccggagagcctatccagatcaga
gtagggattcatactggaccagtcttagcaggtgtcgtgggggacaagatgccccggtac
tgcttgtttggtgacaccgtgaacacagcttctaggatggaaagtcacgggcttcccaac
aaagtgcacctcagccccacagcctacagagccctggaaaatcaagggtttgaaataatt
gagaggggtgaaatccaagtgaaaggaaaaggcaaaatgaccacatactttctgatccag
aatttgaacgcctcagaggatgagatcatggggagacctcaaactctgtttgatcacaaa
ggtaagccaagaagagaagcctcactgtga

DBGET integrated database retrieval system