KEGG   Miniopterus natalensis: 107527538
Entry
107527538         CDS       T05883                                 

Gene name
PDGFC
Definition
(RefSeq) platelet-derived growth factor C isoform X1
  KO
K05450  platelet derived growth factor C/D
Organism
mna  Miniopterus natalensis
Pathway
mna01521  EGFR tyrosine kinase inhibitor resistance
mna04010  MAPK signaling pathway
mna04014  Ras signaling pathway
mna04015  Rap1 signaling pathway
mna04020  Calcium signaling pathway
mna04072  Phospholipase D signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04510  Focal adhesion
mna04540  Gap junction
mna04810  Regulation of actin cytoskeleton
mna05215  Prostate cancer
mna05218  Melanoma
mna05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107527538 (PDGFC)
   04014 Ras signaling pathway
    107527538 (PDGFC)
   04015 Rap1 signaling pathway
    107527538 (PDGFC)
   04020 Calcium signaling pathway
    107527538 (PDGFC)
   04072 Phospholipase D signaling pathway
    107527538 (PDGFC)
   04151 PI3K-Akt signaling pathway
    107527538 (PDGFC)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107527538 (PDGFC)
   04540 Gap junction
    107527538 (PDGFC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107527538 (PDGFC)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    107527538 (PDGFC)
  09162 Cancer: specific types
   05218 Melanoma
    107527538 (PDGFC)
   05215 Prostate cancer
    107527538 (PDGFC)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107527538 (PDGFC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mna04052]
    107527538 (PDGFC)
Cytokines and growth factors [BR:mna04052]
 Growth factors
  Growth factors (RTK binding)
   107527538 (PDGFC)
SSDB
Motif
Pfam: CUB PDGF
Other DBs
NCBI-GeneID: 107527538
NCBI-ProteinID: XP_016055800
LinkDB
Position
Unknown
AA seq 345 aa
MLLFGLLLLTSALAGQRHRAQAESNLSSKFQLSSNKEQNGVQAPQHERIITVSTNGSIHS
PKFPHTYPRNMVLVWRLVAVEENVWIQLTFDERFGLEEPEDDICKYDFVEVEDPSDGTVL
GRWCGSGTVPGKQISKGNQIRIRFVSDEYFPSEPGFCIHYNIVMPQFTEAVSPSVLPPSA
LPLDQLNNAVAAFSTLEDLIRYLEPDRWQLDLEDLYRPGWQLLGKAFVFGRKSGVMDLNL
LKEEVRLYSCTPRNFSVSIREELKRTDAIFWPGCLLVKRCGGNCACCLHNCNECQCVPSK
VTKKYHEVLQLRPKIGVRGLHKSLTDVALEHHEECDCVCRGNAGG
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgctcctcttcgggcttctcctgctgacatccgccctggccggccagagacaccgcgct
caggctgagtccaacctgagtagtaaattccagttgtccagcaacaaggaacagaacgga
gtgcaagctccccagcatgaaagaattattactgtgtctactaatggaagtattcacagc
ccaaagtttcctcatacttatccaagaaatatggtcttggtatggagattagtagcagta
gaggaaaatgtatggatacaacttacatttgatgaaagatttgggcttgaagaaccagaa
gatgacatatgcaagtatgattttgtagaagttgaggaccccagtgatggaactgtatta
gggcgctggtgtggttctgggactgtgccaggaaaacagatttctaaaggaaatcaaatc
aggataagatttgtatctgatgaatatttcccttctgaaccggggttctgcatccactac
aacattgtcatgccacaattcacagaagctgtgagtccttcagtgctgcccccttcagct
ttgccactggaccagcttaataacgctgtcgctgcctttagtaccttggaagatctaatt
cggtatcttgaaccagatagatggcagctggacttagaagatctgtataggccaggttgg
caacttcttggcaaggcttttgtttttggaagaaaatccggagtgatggatctgaacctt
ctaaaagaggaggtaaggttgtacagctgcacacctcgtaacttctcggtgtccataagg
gaagaactaaagagaaccgatgctattttctggccaggttgtctcctggttaaacgctgt
ggtggaaattgtgcctgttgtctccacaattgcaatgagtgtcaatgcgtcccaagcaaa
gttactaaaaaatatcatgaggtccttcagttgagaccaaagatcggtgtcaggggcttg
cataaatctctgactgacgtggccctggagcaccatgaggagtgtgactgcgtgtgcaga
gggaacgcaggaggataa

KEGG   Miniopterus natalensis: 107531241
Entry
107531241         CDS       T05883                                 

Gene name
PDGFB
Definition
(RefSeq) platelet-derived growth factor subunit B
  KO
K17386  platelet-derived growth factor subunit B
Organism
mna  Miniopterus natalensis
Pathway
mna01521  EGFR tyrosine kinase inhibitor resistance
mna04010  MAPK signaling pathway
mna04014  Ras signaling pathway
mna04015  Rap1 signaling pathway
mna04020  Calcium signaling pathway
mna04072  Phospholipase D signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04510  Focal adhesion
mna04540  Gap junction
mna04630  JAK-STAT signaling pathway
mna04810  Regulation of actin cytoskeleton
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05200  Pathways in cancer
mna05206  MicroRNAs in cancer
mna05211  Renal cell carcinoma
mna05214  Glioma
mna05215  Prostate cancer
mna05218  Melanoma
mna05231  Choline metabolism in cancer
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107531241 (PDGFB)
   04014 Ras signaling pathway
    107531241 (PDGFB)
   04015 Rap1 signaling pathway
    107531241 (PDGFB)
   04630 JAK-STAT signaling pathway
    107531241 (PDGFB)
   04020 Calcium signaling pathway
    107531241 (PDGFB)
   04072 Phospholipase D signaling pathway
    107531241 (PDGFB)
   04151 PI3K-Akt signaling pathway
    107531241 (PDGFB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107531241 (PDGFB)
   04540 Gap junction
    107531241 (PDGFB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107531241 (PDGFB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107531241 (PDGFB)
   05206 MicroRNAs in cancer
    107531241 (PDGFB)
   05231 Choline metabolism in cancer
    107531241 (PDGFB)
  09162 Cancer: specific types
   05214 Glioma
    107531241 (PDGFB)
   05218 Melanoma
    107531241 (PDGFB)
   05211 Renal cell carcinoma
    107531241 (PDGFB)
   05215 Prostate cancer
    107531241 (PDGFB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107531241 (PDGFB)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    107531241 (PDGFB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107531241 (PDGFB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mna04052]
    107531241 (PDGFB)
   00536 Glycosaminoglycan binding proteins [BR:mna00536]
    107531241 (PDGFB)
Cytokines and growth factors [BR:mna04052]
 Growth factors
  Growth factors (RTK binding)
   107531241 (PDGFB)
Glycosaminoglycan binding proteins [BR:mna00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   107531241 (PDGFB)
SSDB
Motif
Pfam: PDGF PDGF_N
Other DBs
NCBI-GeneID: 107531241
NCBI-ProteinID: XP_016060759
LinkDB
Position
Unknown
AA seq 210 aa
MLSDHSIRSFDDLQRLLHGDSVDEEVAELDLNLTQSHSGGEPQSLSRGRRSLDSSTVAEP
AMIAECKTRTEVFKISRSLIDRSNANYLVWPPCVEVQRCSGCCNNHKVQCRPTQVQLRHV
QVRKIEIVRKKPTFKKTTVTLEDHLACRCETVVAARPVTRNSGSSQEQPAKMPQTRVTIR
TVRVRRPPKGKHRKFKHTHDKKALKETLGA
NT seq 633 nt   +upstreamnt  +downstreamnt
atgctgagtgaccactcgatccgctccttcgatgacctccagcgcctgctgcacggagac
tccgtagatgaagaggtagccgagctggacctgaatttgacccagtcccattctggaggc
gagccacagagcttatcccgagggagaaggagcctagattcctcaacagttgccgagccc
gccatgattgccgagtgcaagacacgcacggaggtgttcaagatctcccggagcctcatc
gaccgcagcaacgccaactacctggtgtggccgccctgcgtggaggtgcagcgctgctcc
ggctgctgtaacaaccacaaggtgcagtgccgccccacccaggtgcagctgcgacatgtc
caggtgagaaagattgagatcgtgcggaagaaaccgacctttaagaagaccacagtgacc
ctggaggaccacctggcatgcaggtgtgagacagtggttgctgcacgacctgtgacccga
aactcggggagttcccaggagcagccagccaagatgccccaaactcgggtgactattcga
acagtgcgagtccgcaggccccccaaggggaagcacaggaagttcaagcacacgcatgac
aagaaggcgctgaaggagaccctgggagcctag

KEGG   Miniopterus natalensis: 107532411
Entry
107532411         CDS       T05883                                 

Gene name
PDGFD
Definition
(RefSeq) platelet-derived growth factor D isoform X1
  KO
K05450  platelet derived growth factor C/D
Organism
mna  Miniopterus natalensis
Pathway
mna01521  EGFR tyrosine kinase inhibitor resistance
mna04010  MAPK signaling pathway
mna04014  Ras signaling pathway
mna04015  Rap1 signaling pathway
mna04020  Calcium signaling pathway
mna04072  Phospholipase D signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04510  Focal adhesion
mna04540  Gap junction
mna04810  Regulation of actin cytoskeleton
mna05215  Prostate cancer
mna05218  Melanoma
mna05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107532411 (PDGFD)
   04014 Ras signaling pathway
    107532411 (PDGFD)
   04015 Rap1 signaling pathway
    107532411 (PDGFD)
   04020 Calcium signaling pathway
    107532411 (PDGFD)
   04072 Phospholipase D signaling pathway
    107532411 (PDGFD)
   04151 PI3K-Akt signaling pathway
    107532411 (PDGFD)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107532411 (PDGFD)
   04540 Gap junction
    107532411 (PDGFD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107532411 (PDGFD)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    107532411 (PDGFD)
  09162 Cancer: specific types
   05218 Melanoma
    107532411 (PDGFD)
   05215 Prostate cancer
    107532411 (PDGFD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107532411 (PDGFD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mna04052]
    107532411 (PDGFD)
Cytokines and growth factors [BR:mna04052]
 Growth factors
  Growth factors (RTK binding)
   107532411 (PDGFD)
SSDB
Motif
Pfam: CUB PDGF Lectin_C_term
Other DBs
NCBI-GeneID: 107532411
NCBI-ProteinID: XP_016062222
LinkDB
Position
Unknown
AA seq 370 aa
MHRLIFVYTLVCANFCSYRDTSAAPQSSSIKALRNANLRRDESNHLTDLYRRDETIQVTG
NGHLQSPRFPNSYPRNLLLTWRLHSQEKTRIQLAFDNQFGLEEAENDICRYDFVEVEDIS
ETSTIIRGRWCGHKEAPPRITSRTNQIKITFKSDDYFVAKPGFKIYYSFVEDFQPAAASE
TNWESVTSSVSGVSYHSSSVTDSTLTADALDKTIAQFDTVEDLLKHFSPESWQEDLENLY
LDTPHHRGRSYHDRKSKVDLDRLNDDVKRYSCTPRNYSVNLREELKLTGVVFFPRCLLVQ
RCGGNCGCGTANWKSCKCASGKTVKKYHEVLKFDPGHFRRRGRSKYMALVDIQLDHHERC
DCICSSRPPR
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgcaccggctcatcttcgtctacactctcgtgtgcgcaaacttttgcagctatcgggac
acttctgcagccccgcagagctcatccatcaaagctttgcgcaacgccaacctcaggcgc
gatgagagcaatcacctcacagacttgtaccggagagacgaaaccatccaggtgacagga
aatggccacctgcagagtccccgattcccgaacagctaccccaggaacctgcttttgacg
tggcggctccactcccaggagaaaacgaggatacagctggcctttgacaaccagtttgga
ttagaggaagcagaaaacgatatctgtaggtatgattttgtggaagttgaagacatatct
gagaccagcaccattatcagagggcgatggtgcggacacaaggaagctcctcccaggata
acatcgagaacaaaccaaattaaaataacatttaagtctgacgactactttgtggctaaa
cctggattcaagatttattattctttcgtggaagatttccaacccgcagcagcctcagag
accaactgggagtcagtcacaagctctgtctcaggggtctcctatcactcttcatcagta
acggactccactctcactgcggatgctctggacaaaacaattgcacagtttgatacggtg
gaagatctgctcaagcacttcagtcccgaatcctggcaagaagaccttgagaatctgtat
ctggacacccctcatcatcgaggccggtcataccatgacagaaagtcaaaagttgacctg
gacaggctcaatgacgacgtcaagcgttacagctgcacccccagaaactactcggtgaac
ctacgagaggagctgaagctgaccggcgtggtcttcttcccacgttgcctgctcgtgcag
cgctgcggaggcaactgtggctgtgggaccgccaactggaagtcctgcaagtgcgcctca
gggaagactgtgaaaaagtatcacgaggtattaaagtttgaccctggccatttcaggagg
aggggcagatcgaagtacatggctctcgttgacatccagctggatcaccatgagcgatgt
gattgtatctgcagctccaggccacctcgataa

KEGG   Miniopterus natalensis: 107534373
Entry
107534373         CDS       T05883                                 

Gene name
EGF
Definition
(RefSeq) pro-epidermal growth factor
  KO
K04357  epidermal growth factor
Organism
mna  Miniopterus natalensis
Pathway
mna01521  EGFR tyrosine kinase inhibitor resistance
mna04010  MAPK signaling pathway
mna04012  ErbB signaling pathway
mna04014  Ras signaling pathway
mna04015  Rap1 signaling pathway
mna04020  Calcium signaling pathway
mna04066  HIF-1 signaling pathway
mna04068  FoxO signaling pathway
mna04072  Phospholipase D signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04510  Focal adhesion
mna04540  Gap junction
mna04630  JAK-STAT signaling pathway
mna04810  Regulation of actin cytoskeleton
mna05160  Hepatitis C
mna05165  Human papillomavirus infection
mna05200  Pathways in cancer
mna05210  Colorectal cancer
mna05212  Pancreatic cancer
mna05213  Endometrial cancer
mna05214  Glioma
mna05215  Prostate cancer
mna05218  Melanoma
mna05219  Bladder cancer
mna05223  Non-small cell lung cancer
mna05224  Breast cancer
mna05226  Gastric cancer
mna05231  Choline metabolism in cancer
mna05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107534373 (EGF)
   04012 ErbB signaling pathway
    107534373 (EGF)
   04014 Ras signaling pathway
    107534373 (EGF)
   04015 Rap1 signaling pathway
    107534373 (EGF)
   04630 JAK-STAT signaling pathway
    107534373 (EGF)
   04066 HIF-1 signaling pathway
    107534373 (EGF)
   04068 FoxO signaling pathway
    107534373 (EGF)
   04020 Calcium signaling pathway
    107534373 (EGF)
   04072 Phospholipase D signaling pathway
    107534373 (EGF)
   04151 PI3K-Akt signaling pathway
    107534373 (EGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107534373 (EGF)
   04540 Gap junction
    107534373 (EGF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107534373 (EGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107534373 (EGF)
   05231 Choline metabolism in cancer
    107534373 (EGF)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107534373 (EGF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107534373 (EGF)
   05212 Pancreatic cancer
    107534373 (EGF)
   05226 Gastric cancer
    107534373 (EGF)
   05214 Glioma
    107534373 (EGF)
   05218 Melanoma
    107534373 (EGF)
   05219 Bladder cancer
    107534373 (EGF)
   05215 Prostate cancer
    107534373 (EGF)
   05213 Endometrial cancer
    107534373 (EGF)
   05224 Breast cancer
    107534373 (EGF)
   05223 Non-small cell lung cancer
    107534373 (EGF)
  09172 Infectious disease: viral
   05160 Hepatitis C
    107534373 (EGF)
   05165 Human papillomavirus infection
    107534373 (EGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107534373 (EGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mna04052]
    107534373 (EGF)
Cytokines and growth factors [BR:mna04052]
 Growth factors
  Growth factors (RTK binding)
   107534373 (EGF)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition cEGF EGF_CA DUF5050 EGF EGF_3 SGL Plasmod_Pvs28 Tr-sialidase_C
Other DBs
NCBI-GeneID: 107534373
NCBI-ProteinID: XP_016064947
LinkDB
Position
Unknown
AA seq 1213 aa
MRLFLVILLLVVFRFGFSLSALQRWNCPEASPSGNANSTCVGPAPFLIFSHGNSIFRIDL
EGTNHEKLVADAGTSVIMDFHYNNERLYWVDLERQLLQRVFLNGTRQEKVCNIEKNVSGM
AINWINEELIWSNEQEGIITITDMKGNNSRVLLSTLKYPANVAVDPVERFMFWSSEGPSS
LHRADLESMEVKVLLETSEKITAVSLDVLEKRLFWIQYNREGSNSYICSCDYNGGSVHIT
KHLAQHNLFAMSSFGDRIFYSTWRKKTIWIANKHTGRDMVRINLNSSSAPPGGIKVVHPL
VQPNAEHGTWESGPRLCQPGEGHCRGGLCGQEPGSRVCSCAEGFALSPDGKRCEDVNECA
FWNHGCTLGCENIPGSYYCTCPVGFVLLPDGKRCHQLIPCPSNGSECSHDCVLTSDGPMC
FCPEGSVLETDGKTCSGCSSPDNGGCSQLCLALSPVSWECGCLPGYDLQLDKKTCVASGP
QPFLLFANSQDIRHMHFDGTEYRSLLSQQMGAVFALDHDPVENKIYFAHTALKWIERANM
DGSQRETLIEEAVDVPEGLAIDWIDRKLYWTDRGKSVIEVSDLSGKHREIIIKEDISQPR
GIAVHPIAKRLFWTDMGINPRIESSSLQGAGRLLIASSELVWPSGITIDFLTDKLYWCDA
KQSVIEMANLDGSERQRLAQNDVGHPFAVAVFEDHVWFSDWTVPSVIRVNKRTGKNRVRL
RGSMLKPSSLVVVHPLAKPGADPCLYQNGGCEHICKAKFGTAQCSCREGFVKAPDGKMCL
ALNGHQTSAGSEADLSNEVMPSDAAPSSQGFGGDITESQPVLVAEIMASDEDDCGPVGCG
PHSQCISEGEVATCQCLRGFAGDGKVCSDIDECEMGSAACQHPSSTCVNTEGGYVCRCSE
GHRGNGTHCLDIDECQLGVHACGENATCINTEGNYTCLCAGSLSEPGLICPDSTPPPALR
EDGRSSVRNGYSECPLSHAGYCLHGGMCMFIEAVDHYACNCVVGYVGERCQHRDLKWWEL
RHAGHGRQRNVTVVAVCVVVLVLLLLLGLWGAHYYRTQKLLAKNPRNPYEESNRDVSTSR
PSDGEAGMSSGPQPWFVVLKQHQNLRNGNQPEAPQDSQAADVGQFPSPQPASMQPTPWRK
EPQMCPGTDQGSCIPPPRDNGSGPQRTKGSFPLPSCGAQPIAVGDERPHSLRLANPSWPQ
RAPDPPHQMELTQ
NT seq 3642 nt   +upstreamnt  +downstreamnt
atgcggctcttccttgtcattctgttgctggtagtttttagatttggctttagtctctca
gcactccagcgctggaactgtcctgaagcctccccctcgggaaatgcgaattctacttgc
gtgggtcctgcacccttcttaattttctcgcatggaaatagtatctttaggattgacctg
gaaggaaccaatcatgagaaattggtggcagatgctggcacatcggtgatcatggatttt
cattacaataatgaaagactctattgggtagatctagaaagacaacttttgcaaagagtt
tttctgaatgggacaagacaagagaaagtatgcaatatagagaaaaatgtttcaggaatg
gcaatcaattggataaatgaagaacttatttggtcaaatgaacaggaaggaatcattacc
ataacagatatgaaaggaaacaattcccgtgttctcttaagcaccttaaaatatcctgca
aatgtagcagttgatccagtagaaaggtttatgttttggtcttcagaggggcccagcagc
ctccacagagcagatctcgagagtatggaagtgaaggttctgttagagacatcagagaaa
ataacagctgtgtccctggatgtgcttgagaagcggctcttttggattcagtacaacaga
gaaggaagcaattcttatatttgttcctgtgattataacggaggttctgtccacatcacc
aaacatcttgcacagcacaatttgtttgcaatgtcctcttttggtgaccgtatcttctac
tcaacatggagaaagaagacaatttggatagctaacaaacacaccgggagggatatggtt
agaattaacctcaactcatcatctgcgccgcctggtggaattaaagtggtgcacccgctg
gtgcagcccaacgccgaacacggcacgtgggagtccggtccgcggctctgccaaccgggc
gaaggtcactgcagaggaggcctgtgcgggcaggagcccgggtcccgcgtgtgctcgtgc
gcggagggcttcgctctgagccccgacgggaagcgctgcgaagatgtcaacgaatgtgcc
ttttggaatcacggctgtactcttgggtgtgaaaacatccccggatcctattattgcacg
tgcccggtaggatttgttctgcttcctgatgggaaacggtgtcaccaattaattccctgc
ccaagcaatgggtctgaatgcagccatgactgtgttctgacctcagatggtcccatgtgt
ttctgtcctgaaggctcagtgcttgagacagatggaaaaacgtgtagtggctgctcatcg
cctgataacggtggatgtagccagctctgccttgctctcagcccagtatcctgggagtgt
ggctgccttcctgggtacgaccttcaactggacaaaaaaacctgtgtagcttcaggacca
cagccgtttctgctgtttgccaattctcaagatatccgccacatgcattttgatgggaca
gagtacagaagcctgctcagccagcagatgggagcggttttcgccctagatcatgaccct
gtggaaaataagatatactttgcccatacagccctgaagtggatagagagagccaatatg
gatggttcccagcgagaaacgcttatcgaggaagcagtagatgttccagaaggccttgcc
atagactggattgaccgtaaactctactggacagacagagggaaatctgttattgaagtc
agtgacttaagtggaaaacatcgtgaaataatcattaaggaggacatctctcagccacga
ggaattgctgttcatccaatagccaagagattattctggaccgatatggggattaaccca
cgaattgaaagttcttcccttcaaggagctggccggctgcttatcgccagctccgagctg
gtctggcccagtggaataacgattgatttcctaactgacaagttgtactggtgcgatgcc
aagcagtctgtgattgaaatggccaatctggatggttcagaacgccaaagacttgcccag
aacgatgtaggtcacccatttgctgtggctgtgtttgaggatcatgtgtggttttctgat
tggactgtgccctcggtaataagggtgaacaagaggactggcaaaaatagggtacgtctc
cgaggcagcatgctgaagccctcatcactggttgtagttcatccattggcaaaaccagga
gcagatccctgcttatatcaaaatggaggctgtgaacatatttgcaaagcgaagtttgga
actgctcagtgttcatgtcgtgaaggttttgtgaaagccccagatgggaaaatgtgtctg
gctctaaatggtcatcagacttcagcaggtagcgaagcagatctaagtaatgaagtgatg
ccttcggacgccgcccccagcagccaggggtttggaggtgacatcacagaatctcagcct
gtgctcgtggccgagatcatggcctcagatgaagacgactgtggtcccgtgggatgtgga
ccacactcccaatgcatttcagagggagaggttgccacgtgccagtgtttgagaggattt
gctggggatggaaaagtatgttctgacatagatgaatgtgagatgggaagcgccgcgtgc
cagcacccctcctccacgtgcgtcaacaccgaaggcggctatgtttgccggtgctccgaa
ggccaccgaggaaacgggacacactgccttgatattgatgagtgccagctgggcgtgcac
gcctgtggggaaaatgctacctgcataaatacggagggaaactacacctgcctgtgtgcc
ggcagcctgtctgagcccggactgatctgccctgactcgactccgccgcctgccctcagg
gaggatgggcgctcctccgtgaggaacggctactcggagtgccccctgtcccacgcgggg
tactgcctccacggcgggatgtgcatgttcatcgaggccgtggaccactacgcctgcaac
tgtgttgttggctacgttggggagcgatgtcagcaccgagacttgaaatggtgggagctg
cgccacgcgggccacgggcggcagcggaacgtcaccgtggtggccgtctgcgtggtggtg
ctcgtcctgctgctgctcctggggctgtggggcgctcactactacaggactcagaagctg
ctagcgaaaaatccaagaaacccttatgaagagtcgaatagagatgtgagcactagcaga
ccttcagatggagaggctgggatgtcctctggtcctcaaccttggtttgtggttttaaag
caacaccagaatctcaggaatgggaatcaacctgaggcccctcaagacagccaggcagca
gatgttggccagtttccctccccgcagcctgcgtcaatgcaaccgacaccttggaggaaa
gagccccagatgtgcccgggaacagaccagggcagctgcatcccgccaccccgtgataac
ggctctggtccccagagaacgaagggtagctttcctctcccctcgtgtggggcacagccc
attgctgtgggggatgagaggccccattctctccggttggctaacccatcatggccacag
agggccccggatccaccacaccagatggagctgactcagtga

KEGG   Miniopterus natalensis: 107543141
Entry
107543141         CDS       T05883                                 

Gene name
PDGFA
Definition
(RefSeq) platelet-derived growth factor subunit A
  KO
K04359  platelet-derived growth factor subunit A
Organism
mna  Miniopterus natalensis
Pathway
mna01521  EGFR tyrosine kinase inhibitor resistance
mna04010  MAPK signaling pathway
mna04014  Ras signaling pathway
mna04015  Rap1 signaling pathway
mna04020  Calcium signaling pathway
mna04072  Phospholipase D signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04510  Focal adhesion
mna04540  Gap junction
mna04630  JAK-STAT signaling pathway
mna04810  Regulation of actin cytoskeleton
mna05200  Pathways in cancer
mna05202  Transcriptional misregulation in cancer
mna05206  MicroRNAs in cancer
mna05214  Glioma
mna05215  Prostate cancer
mna05218  Melanoma
mna05231  Choline metabolism in cancer
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107543141 (PDGFA)
   04014 Ras signaling pathway
    107543141 (PDGFA)
   04015 Rap1 signaling pathway
    107543141 (PDGFA)
   04630 JAK-STAT signaling pathway
    107543141 (PDGFA)
   04020 Calcium signaling pathway
    107543141 (PDGFA)
   04072 Phospholipase D signaling pathway
    107543141 (PDGFA)
   04151 PI3K-Akt signaling pathway
    107543141 (PDGFA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107543141 (PDGFA)
   04540 Gap junction
    107543141 (PDGFA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107543141 (PDGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107543141 (PDGFA)
   05202 Transcriptional misregulation in cancer
    107543141 (PDGFA)
   05206 MicroRNAs in cancer
    107543141 (PDGFA)
   05231 Choline metabolism in cancer
    107543141 (PDGFA)
  09162 Cancer: specific types
   05214 Glioma
    107543141 (PDGFA)
   05218 Melanoma
    107543141 (PDGFA)
   05215 Prostate cancer
    107543141 (PDGFA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107543141 (PDGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107543141 (PDGFA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mna04052]
    107543141 (PDGFA)
   00536 Glycosaminoglycan binding proteins [BR:mna00536]
    107543141 (PDGFA)
Cytokines and growth factors [BR:mna04052]
 Growth factors
  Growth factors (RTK binding)
   107543141 (PDGFA)
Glycosaminoglycan binding proteins [BR:mna00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   107543141 (PDGFA)
SSDB
Motif
Pfam: PDGF PDGF_N
Other DBs
NCBI-GeneID: 107543141
NCBI-ProteinID: XP_016076083
LinkDB
Position
Unknown
AA seq 193 aa
MKRTVLTQSRTLNQTPPEALGSLHRPVQSPEAESAWLRQAAGHCFFSVPLGAEDALESSL
RVHGGRATKHAPEKRPVPIRRKRSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPC
VEVRRCTGCCNTSSVRCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECTCMPTS
LNPDYREEETDVR
NT seq 582 nt   +upstreamnt  +downstreamnt
atgaagaggaccgtgttgacacagagcagaacccttaatcagaccccccctgaagccctg
ggctcgctgcatcggccagtccagtcccccgaggccgagagcgcctggctgagacaggca
gctggtcactgtttcttctctgtacctttaggggctgaggatgccctggagagcagcctg
agagtccacgggggccgcgccaccaagcacgcacctgagaagcggcccgtgcccattcgg
aggaagaggagcattgaggaagctgtccctgccgtctgcaagaccaggacggtcatttac
gagatacctcggagccaggtggaccccacatctgccaacttcctgatctggccaccgtgc
gtggaggtgagacgctgcactggctgctgcaacaccagcagcgtccggtgccagccgtcc
cgcgtgcaccaccgcagcgtcaaggtggccaaggtggagtacgtcaggaagaagccaaag
ttaaaagaagtccaggtgaggctggaggagcacctggagtgcacgtgcatgcccaccagc
ctgaaccccgattaccgagaagaggagacagatgtgaggtga

DBGET integrated database retrieval system