KEGG   Miniopterus natalensis: 107527747
Entry
107527747         CDS       T05883                                 

Gene name
E2F1
Definition
(RefSeq) transcription factor E2F1
  KO
K17454  transcription factor E2F1
Organism
mna  Miniopterus natalensis
Pathway
mna01522  Endocrine resistance
mna04110  Cell cycle
mna04137  Mitophagy - animal
mna04218  Cellular senescence
mna04934  Cushing syndrome
mna05160  Hepatitis C
mna05161  Hepatitis B
mna05163  Human cytomegalovirus infection
mna05165  Human papillomavirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05169  Epstein-Barr virus infection
mna05200  Pathways in cancer
mna05206  MicroRNAs in cancer
mna05212  Pancreatic cancer
mna05214  Glioma
mna05215  Prostate cancer
mna05218  Melanoma
mna05219  Bladder cancer
mna05220  Chronic myeloid leukemia
mna05222  Small cell lung cancer
mna05223  Non-small cell lung cancer
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    107527747 (E2F1)
  09143 Cell growth and death
   04110 Cell cycle
    107527747 (E2F1)
   04218 Cellular senescence
    107527747 (E2F1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107527747 (E2F1)
   05206 MicroRNAs in cancer
    107527747 (E2F1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    107527747 (E2F1)
   05225 Hepatocellular carcinoma
    107527747 (E2F1)
   05226 Gastric cancer
    107527747 (E2F1)
   05214 Glioma
    107527747 (E2F1)
   05220 Chronic myeloid leukemia
    107527747 (E2F1)
   05218 Melanoma
    107527747 (E2F1)
   05219 Bladder cancer
    107527747 (E2F1)
   05215 Prostate cancer
    107527747 (E2F1)
   05224 Breast cancer
    107527747 (E2F1)
   05222 Small cell lung cancer
    107527747 (E2F1)
   05223 Non-small cell lung cancer
    107527747 (E2F1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107527747 (E2F1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107527747 (E2F1)
   05161 Hepatitis B
    107527747 (E2F1)
   05160 Hepatitis C
    107527747 (E2F1)
   05163 Human cytomegalovirus infection
    107527747 (E2F1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107527747 (E2F1)
   05169 Epstein-Barr virus infection
    107527747 (E2F1)
   05165 Human papillomavirus infection
    107527747 (E2F1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107527747 (E2F1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mna03000]
    107527747 (E2F1)
Transcription factors [BR:mna03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    107527747 (E2F1)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP TP1
Other DBs
NCBI-GeneID: 107527747
NCBI-ProteinID: XP_016056059
LinkDB
Position
Unknown
AA seq 360 aa
NAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVKSPGEKSRYETSLNLTT
KRFLELLSRSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLIAKKSKNHIQWLGNHAT
VGIGGRLEGLTQDLQQLQENERQLDHLIHVCTTQLRLLSEDADSQRLAYVTCQDLRSIAD
PAEQMVMVIKAPPETQLQAVDSSETFQISLKSKQGPIDVFLCPEENVGGISPGKTPSPGA
SSGEEDRAADPATTVPPSSSPPSTSDTDPSQPLLSLEQEPLLSRMGGLRAPMDEDHLSPL
VAADSLLEHVREDFSSFLPEEFISLSPPHGALDYHFGLEEGEGIRDLFDCDFGDLTPLDF
NT seq 1083 nt   +upstreamnt  +downstreamnt
aacgcgccgcgcccggcgctcggccgcccgccggtgaagcggagactggacctggaaact
gaccatcaatacctggctgagagcagtgggccagctcggggaagaggccgccacccagga
aaaggtgtgaaatccccaggggagaagtcacgctatgagacatccctgaatctgaccacc
aaacgcttcctggagctgctgagccgctcggctgatggagttgttgatctgaactgggca
gctgaggtgctgaaagtgcagaaacggcgaatctatgatatcaccaatgtccttgagggc
attcagctcatcgccaagaagtccaagaaccatatccaatggctaggcaaccacgccacg
gtagggatcggtgggcggcttgaaggactgacccaggacctccagcaactgcaggagaat
gaacggcagctggaccacctgatccacgtctgtaccactcaacttcggctgctttccgag
gatgctgacagccaacgcctggcctacgtgacttgccaggaccttcgtagcattgcagat
cctgcagagcagatggtcatggtgatcaaggccccccctgagacccagcttcaagccgtg
gactcctcagagacctttcagatctcccttaagagcaaacaaggccctatcgatgttttc
ctgtgccctgaagagaatgtgggcgggatcagccccgggaagaccccatccccaggagca
tcttctggggaggaggacagggcagctgatcctgccaccacagtgccaccatcatcatct
cccccctcaacctctgacacggatcccagccagcccctgctcagcctggagcaagaacct
ctgctctcccggatgggtggcctgcgggcccccatggacgaggaccacctgtctccgctg
gtggcggccgactcactcctggagcatgtgcgggaggacttctccagcttcctccctgag
gaattcatcagtctgtctcccccacacggggccctcgactaccactttggccttgaggag
ggcgagggcatcagagacctcttcgactgtgactttggggacctcacccccctggatttc
tga

KEGG   Miniopterus natalensis: 107538329
Entry
107538329         CDS       T05883                                 

Gene name
E2F2
Definition
(RefSeq) transcription factor E2F2
  KO
K09389  transcription factor E2F2
Organism
mna  Miniopterus natalensis
Pathway
mna01522  Endocrine resistance
mna04110  Cell cycle
mna04218  Cellular senescence
mna04934  Cushing syndrome
mna05160  Hepatitis C
mna05161  Hepatitis B
mna05163  Human cytomegalovirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05169  Epstein-Barr virus infection
mna05200  Pathways in cancer
mna05206  MicroRNAs in cancer
mna05212  Pancreatic cancer
mna05214  Glioma
mna05215  Prostate cancer
mna05218  Melanoma
mna05219  Bladder cancer
mna05220  Chronic myeloid leukemia
mna05222  Small cell lung cancer
mna05223  Non-small cell lung cancer
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107538329 (E2F2)
   04218 Cellular senescence
    107538329 (E2F2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107538329 (E2F2)
   05206 MicroRNAs in cancer
    107538329 (E2F2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    107538329 (E2F2)
   05225 Hepatocellular carcinoma
    107538329 (E2F2)
   05226 Gastric cancer
    107538329 (E2F2)
   05214 Glioma
    107538329 (E2F2)
   05220 Chronic myeloid leukemia
    107538329 (E2F2)
   05218 Melanoma
    107538329 (E2F2)
   05219 Bladder cancer
    107538329 (E2F2)
   05215 Prostate cancer
    107538329 (E2F2)
   05224 Breast cancer
    107538329 (E2F2)
   05222 Small cell lung cancer
    107538329 (E2F2)
   05223 Non-small cell lung cancer
    107538329 (E2F2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107538329 (E2F2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107538329 (E2F2)
   05161 Hepatitis B
    107538329 (E2F2)
   05160 Hepatitis C
    107538329 (E2F2)
   05163 Human cytomegalovirus infection
    107538329 (E2F2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107538329 (E2F2)
   05169 Epstein-Barr virus infection
    107538329 (E2F2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107538329 (E2F2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mna03000]
    107538329 (E2F2)
Transcription factors [BR:mna03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    107538329 (E2F2)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP FerA N1221
Other DBs
NCBI-GeneID: 107538329
NCBI-ProteinID: XP_016070026
LinkDB
Position
Unknown
AA seq 440 aa
MPSNKRPSSVGEAPASGPPLKALPAVSPTELWAPGLGSPQLCPVTTTYYTSLYPQAVPPA
AVSRTCLDATPHGPEGQAVRCVPAGRLPAKRKLDLEGIGRPAILGFQTPKGKYIRVDGFP
SPKTPKSPGEKTRYDTSLGLLTKKFIYLLSESKDGVLDLNWAAEVLDVQKRRIYDITNVL
EGIQLIRKKAKNNIQWVGRGAFEDPTRPGKQQQLGQELKELMSTEQALDQLIQSCSQNFK
HLTEDKANKKLAYVTYQDIRAIGTFKEQTVIAVKAPPQTRLEVPDKSEENLQIHLKSTQG
PIEVYLCPEEMQEPDSPAKEPVPSTSTLSPTPDSAQPSSSTNPGILEPTASPAPLLTSQQ
VLLPPASLVPLEATDSMLELPHPLLQQTEDQFLSPTLTDSSPLISFSPPLDQDDYLWGLD
GGEGISDLFDSYDFGDLLIN
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgcccagtaacaaaaggccctccagcgtgggtgaggcgccggcctccgggccgcccctg
aaggcgctgcccgcggtgagccccaccgaactgtgggcgcctggcctcggcagcccccag
ctctgcccggtcaccaccacctactacacctcgctgtacccgcaggctgtgcctcccgct
gcggtgtcccgcacctgcctcgacgccaccccccacggaccggagggccaagctgtgcgg
tgcgtgccggctggccggctgccggccaaaaggaagctggacctggaggggatcgggagg
cctgcgatcctgggattccagactcccaaggggaagtacattagagtggatggcttcccc
agccctaaaacacccaagtcccctggggagaagactcggtatgacacatcactggggctg
ctcaccaagaagttcatttacctcctgagtgagtccaaggatggggtcctggacttgaat
tgggctgctgaggtgctggacgtgcagaagcggcgcatctatgacatcaccaacgtgctg
gagggcatccagctcatccgcaagaaggccaagaacaacatccagtgggtgggcagggga
gcttttgaagaccccacccggcctgggaagcagcagcagctggggcaggagctgaaggag
ctgatgagtacagagcaggccttggaccagctcatccagagctgctctcagaacttcaag
cacctgaccgaggacaaagccaacaagaaactggcctatgtgacttaccaggacatccgt
gctattggcacctttaaggagcagacagtgattgctgtcaaggctcctccgcagacaaga
ctggaagtgcccgacaagagcgaggagaacctgcagatacatctgaagagcacgcagggg
cccatcgaagtctacctgtgcccggaggagatgcaggaaccagacagccctgccaaggag
cccgtcccctccacgtctaccctcagccccactcctgactctgcccagcccagcagcagc
accaaccctgggatcctggaacccacggcatccccagcgccactgctgacttcccagcag
gtcctgctgccaccagcatcccttgtccctctggaggccactgacagcatgctggaactg
ccacaccctcttctgcagcagaccgaggaccagttcctgtccccaaccctgacagacagc
tcccctctgatcagtttctctccgcccttggaccaggatgactacctgtggggcctggat
gggggcgaaggcatcagtgacctctttgactcctatgactttggggacctgctgattaat
tga

KEGG   Miniopterus natalensis: 107539632
Entry
107539632         CDS       T05883                                 

Gene name
E2F3
Definition
(RefSeq) transcription factor E2F3 isoform X1
  KO
K06620  transcription factor E2F3
Organism
mna  Miniopterus natalensis
Pathway
mna01522  Endocrine resistance
mna04110  Cell cycle
mna04218  Cellular senescence
mna04934  Cushing syndrome
mna05160  Hepatitis C
mna05161  Hepatitis B
mna05163  Human cytomegalovirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05169  Epstein-Barr virus infection
mna05200  Pathways in cancer
mna05206  MicroRNAs in cancer
mna05212  Pancreatic cancer
mna05214  Glioma
mna05215  Prostate cancer
mna05218  Melanoma
mna05219  Bladder cancer
mna05220  Chronic myeloid leukemia
mna05222  Small cell lung cancer
mna05223  Non-small cell lung cancer
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107539632 (E2F3)
   04218 Cellular senescence
    107539632 (E2F3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107539632 (E2F3)
   05206 MicroRNAs in cancer
    107539632 (E2F3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    107539632 (E2F3)
   05225 Hepatocellular carcinoma
    107539632 (E2F3)
   05226 Gastric cancer
    107539632 (E2F3)
   05214 Glioma
    107539632 (E2F3)
   05220 Chronic myeloid leukemia
    107539632 (E2F3)
   05218 Melanoma
    107539632 (E2F3)
   05219 Bladder cancer
    107539632 (E2F3)
   05215 Prostate cancer
    107539632 (E2F3)
   05224 Breast cancer
    107539632 (E2F3)
   05222 Small cell lung cancer
    107539632 (E2F3)
   05223 Non-small cell lung cancer
    107539632 (E2F3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107539632 (E2F3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107539632 (E2F3)
   05161 Hepatitis B
    107539632 (E2F3)
   05160 Hepatitis C
    107539632 (E2F3)
   05163 Human cytomegalovirus infection
    107539632 (E2F3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107539632 (E2F3)
   05169 Epstein-Barr virus infection
    107539632 (E2F3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107539632 (E2F3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mna03000]
    107539632 (E2F3)
Transcription factors [BR:mna03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    107539632 (E2F3)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 107539632
NCBI-ProteinID: XP_016071682
LinkDB
Position
Unknown
AA seq 340 aa
MPLQQQAKRRLELGESGHQYLSDGLKTPKGKGRAALRSPDSPKTPKSPSEKTRYDTSLGL
LTKKFIQLLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNNVQWMGCS
LSEDGGMLAQCQGLSKEVTELSQEEKKLDELIQSCTLDLKLLTEDSENQRLAYVTYQDIR
KISGLKDQTVIVVKAPPETRLEVPDPVESLQIHLASTQGPIEVYLCPEETETHSPMKTNN
QDHNGNIPKPTSKDLASTNSGHSDCSISMANLSPLASPANLLQQTEDQIPSNLEGPFVNL
LPPLLQEDYLLSLGEEEGISDLFDAYDLEKLPLVEDFMCS
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgcccttacagcagcaggccaagcgaaggctggagctaggagaaagcggtcatcagtac
ctctcagatggtttaaaaacccccaagggcaaagggagagctgcactgcgaagtcctgac
agtcccaaaactccaaaatctccctcagaaaaaacacggtatgatacatcacttggtctg
ctcaccaagaagttcattcagctactgagccagtcacctgatggggtcttggatttgaac
aaggcagcagaggtgctgaaagtgcaaaagagaaggatctatgatatcaccaatgtgctg
gaaggcatccacctcattaagaagaagtctaaaaacaacgtgcaatggatgggctgcagt
ctgtctgaggatgggggcatgctggcccagtgtcaaggcctgtcaaaggaagtgaccgag
ctcagtcaggaagaaaagaaattagatgaactgatccaaagctgcaccctggacctcaaa
ctgttaaccgaggattcagagaatcaaaggttagcttatgttacatatcaagatattcga
aaaattagtggccttaaagaccaaactgttatagttgtgaaagcccctccagaaacaaga
cttgaagtgcctgacccagtagagagcctgcaaatacacttggcaagtactcaagggccc
attgaggtttacttgtgtccagaagagactgaaacacatagtccaatgaaaacaaacaac
caagaccacaatgggaatatccctaaacccacttccaaagacttggcttcaaccaactca
ggacatagtgattgctcgatttctatggcaaacctttctcctttggcctccccagccaac
cttttacagcagactgaggaccaaattccttccaacctcgaaggaccatttgtgaactta
ctgcctcccctgctccaagaagactatctcctaagcctcggggaggaagaaggtatcagt
gatctcttcgatgcttatgatttggaaaagctcccgctggtggaagacttcatgtgtagt
tga

DBGET integrated database retrieval system