KEGG   Miniopterus natalensis: 107527759
Entry
107527759         CDS       T05883                                 

Gene name
MYLK2
Definition
(RefSeq) myosin light chain kinase 2, skeletal/cardiac muscle
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
mna  Miniopterus natalensis
Pathway
mna04020  Calcium signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04270  Vascular smooth muscle contraction
mna04371  Apelin signaling pathway
mna04510  Focal adhesion
mna04611  Platelet activation
mna04810  Regulation of actin cytoskeleton
mna04921  Oxytocin signaling pathway
mna04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107527759 (MYLK2)
   04020 Calcium signaling pathway
    107527759 (MYLK2)
   04022 cGMP-PKG signaling pathway
    107527759 (MYLK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107527759 (MYLK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107527759 (MYLK2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107527759 (MYLK2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107527759 (MYLK2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107527759 (MYLK2)
  09154 Digestive system
   04971 Gastric acid secretion
    107527759 (MYLK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107527759 (MYLK2)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     107527759 (MYLK2)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   107527759 (MYLK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH
Other DBs
NCBI-GeneID: 107527759
NCBI-ProteinID: XP_016056070
LinkDB
Position
Unknown
AA seq 599 aa
MATENEAVELGTQSSSTDKAPKGAAGEGPPASEKDPAPPDPKKDPGPPTLKKGAKAPAPE
KGDGALAQPSTSSPGPDGEGDLGGGPAEGSVGQPAALPQQTQTAEASVKKLNDRDAQESP
GSQDPGEPKERKKAAEGQAAARRGSPAFLHSPSCPAAISSPEKLLAEKPPNETSELIFEG
VPVAPGPTDPMPTKAAAGGKNILEGSQKEAGEKASGQAGQAEVQGDTSRGIEFQAVPPER
SEVGQALCLTAREEDCFQILDDCPPPPAPFPHRIVELRTGNVNSQFSMNSKETLGGGKFG
AVCTCTEKATGLKLAAKVIKKQTPKDKEMVMLEIEVMNQLNHRNLIQLYAAIETPHDIIL
FLEYIEGGELFERIVDDDYQLTEVDTMVFVRQICDGILFMHEMQVLHLDLKPENILCVNT
TGHLVKIIDFGLARRYNPNEKLKVNFGTPEFLSPEVVNYDQISDKTDMWSMGVITYMLLS
GLSPFLGDDDTETLNNVLSANWYFDEETFEAVSDEAKDFVSNLIVKEQGARMSAAQCLAH
PWLNNLAEKAKRCNRRLKSQILLKKYLMKRRWKKNFIAVSAANRFKKISSSGALMALGV
NT seq 1800 nt   +upstreamnt  +downstreamnt
atggcgacagaaaacgaagcagtggagctgggaacccagagctcatcaacagacaaggca
cctaaaggtgcagcaggcgaaggacccccagcttcagagaaagaccctgcccccccagac
ccaaagaaagaccctggtccacccaccctgaagaaaggtgccaaagcccctgccccagag
aagggggatggtgccctagcccagccctcaactagcagcccgggccctgatggagaagga
gacttgggcggggggcctgcggagggcagtgtggggcagccagcagccctgccccagcag
acccagacagctgaggccagtgtcaagaagctcaacgaccgcgatgctcaggagtccccg
ggcagccaggatcctggagagcccaaggagcgcaagaaggcagcagagggccaagcagcc
gccaggaggggctcaccggcctttctacacagccccagctgccctgcggccatctccagc
cctgagaagctgctggccgagaagcccccaaatgagacatcagagctcatctttgaaggg
gtgcccgtggcccccggccccacggatcccatgccaaccaaagcagcagcaggagggaaa
aacatcctggaaggcagccagaaggaagcaggagagaaggcttcaggccaggctggccag
gctgaggtgcaaggggacacctcgagggggatcgagttccaggctgtgcccccggagaga
tcagaggtggggcaggccctctgtctcacagccagggaggaggactgcttccagattttg
gatgattgcccgccacccccggcccccttcccccaccgcattgtggagctgaggaccggg
aatgtcaacagtcagttcagcatgaactccaaggagacgctgggcggtggcaagtttgga
gcagtctgtacctgcacagagaaagccacaggcctcaagttggcagccaaggtcatcaag
aaacagacacctaaagacaaggaaatggtgatgcttgagatcgaggttatgaaccagcta
aaccaccgcaatctgatccagctctacgcagccatcgagaccccacacgacataatcctg
ttcttggagtacatcgagggcggcgagctcttcgagaggattgtggatgacgactatcag
ctgaccgaggtggacaccatggtgtttgtcaggcagatctgcgacgggatcctcttcatg
cacgagatgcaggttctgcacctggacctcaagccagagaacatcctgtgcgtcaacacc
acgggccatttggtgaagatcattgacttcggcctggcacggaggtataaccccaacgag
aagctgaaggtgaattttgggaccccagagttcctgtcacctgaggtggtgaattacgac
caaatctccgacaagacagacatgtggagtatgggggtcatcacctacatgctgctgagc
ggcctctcccccttcctgggagatgatgacacagagaccctaaacaatgttctatctgcc
aactggtactttgatgaggagaccttcgaggctgtgtcagatgaggccaaagactttgtc
tccaacctcatcgtcaaggagcagggggcccgcatgagcgctgcccagtgcctcgcccac
ccctggctcaacaacctggcagagaaagccaagcgctgtaatcgacgcctcaagtcccag
atcttgcttaagaaatacctcatgaagagacgctggaagaaaaacttcattgctgtcagc
gctgccaatcgcttcaagaagatcagcagctcgggggcactgatggctctgggggtctga

KEGG   Miniopterus natalensis: 107542256
Entry
107542256         CDS       T05883                                 

Gene name
MYLK4
Definition
(RefSeq) myosin light chain kinase family member 4
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
mna  Miniopterus natalensis
Pathway
mna04020  Calcium signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04270  Vascular smooth muscle contraction
mna04371  Apelin signaling pathway
mna04510  Focal adhesion
mna04611  Platelet activation
mna04810  Regulation of actin cytoskeleton
mna04921  Oxytocin signaling pathway
mna04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107542256 (MYLK4)
   04020 Calcium signaling pathway
    107542256 (MYLK4)
   04022 cGMP-PKG signaling pathway
    107542256 (MYLK4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107542256 (MYLK4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107542256 (MYLK4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107542256 (MYLK4)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107542256 (MYLK4)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107542256 (MYLK4)
  09154 Digestive system
   04971 Gastric acid secretion
    107542256 (MYLK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107542256 (MYLK4)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     107542256 (MYLK4)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   107542256 (MYLK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH Kinase-like
Other DBs
NCBI-GeneID: 107542256
NCBI-ProteinID: XP_016075012
LinkDB
Position
Unknown
AA seq 346 aa
ISPFLIVYPQAKGKVWSYPNQEEMAPVKGKGTSAPTGDGPAPPAPFHHRIVVAKQTAVNS
LYTVSRTEILGGGRFGQVHKCEEKATGLKLAAKVIKTRDAKDKDSVRNEIAVMNQLDHVN
LIQLYDAFESKNDIVLVMEYVEGGELFDRIIDDNYNLTELDTILFIEQICEGIRHMHQMY
ILHLDLKPENILCVNRDAKQIKIIDFGLARRYKPREKLKVNFGTPEFLAPEVVNYDFVSF
PTDMWSVGVIAYMLLSGLSPFLGDNDAETLSNILACRWDLEEEEFQNVSEEAKEFISKLL
IKEKSWRISASEALKHPWLSDHKLRSRLRAQKKKNYCSDAQDLVAQ
NT seq 1041 nt   +upstreamnt  +downstreamnt
atatccccattcctcattgtatatccacaggctaaggggaaggtgtggtcataccccaac
caggaagaaatggcacccgtcaagggcaaggggacctcagcccccacaggcgacggccca
gcccctccggcaccctttcaccaccggatcgtagtagccaagcagacagctgtcaacagc
ctttacactgtgagcagaacagaaattttaggcggggggcgcttcggccaggttcacaag
tgtgaggagaaagcgacaggtctgaagctggcggccaaggtcatcaagaccagagacgcg
aaggacaaggactccgtgagaaacgagatcgccgtcatgaaccagctggatcacgtgaac
ctcattcagctctacgacgcctttgagtctaagaatgacatcgtcctggtcatggagtac
gtggagggaggcgagctgtttgaccggatcattgacgacaactacaatctgactgagctg
gacaccatcctgttcatcgagcagatatgtgagggaatacggcacatgcaccagatgtac
attctccatctggacctgaagcctgagaatatcctgtgtgtgaatcgggatgctaaacaa
ataaagattattgattttggattggccagaagatacaaacccagggagaagttgaaggtg
aactttggaaccccagaatttctcgcccccgaagttgtgaactatgacttcgtttccttt
cccacggacatgtggagtgtgggggtcatcgcctacatgctacttagtggtctgtccccc
ttcctgggcgataatgacgccgagaccctgagcaacatcctggcctgcaggtgggactta
gaggaggaggaatttcagaacgtctcggaggaggccaaggagttcatctccaagcttctc
attaaggagaagagctggcgaataagtgcaagtgaagctctcaagcacccttggctgtca
gaccacaagctccgctccagactcagagcacagaaaaagaagaactactgctcggatgct
caggaccttgtggcccaatag

DBGET integrated database retrieval system