KEGG   Miniopterus natalensis: 107527774
Entry
107527774         CDS       T05883                                 

Gene name
IGF1R
Definition
(RefSeq) insulin-like growth factor 1 receptor isoform X1
  KO
K05087  insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
mna  Miniopterus natalensis
Pathway
mna01521  EGFR tyrosine kinase inhibitor resistance
mna01522  Endocrine resistance
mna04010  MAPK signaling pathway
mna04014  Ras signaling pathway
mna04015  Rap1 signaling pathway
mna04066  HIF-1 signaling pathway
mna04068  FoxO signaling pathway
mna04114  Oocyte meiosis
mna04140  Autophagy - animal
mna04144  Endocytosis
mna04150  mTOR signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04152  AMPK signaling pathway
mna04211  Longevity regulating pathway
mna04213  Longevity regulating pathway - multiple species
mna04510  Focal adhesion
mna04520  Adherens junction
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04730  Long-term depression
mna04913  Ovarian steroidogenesis
mna04914  Progesterone-mediated oocyte maturation
mna05200  Pathways in cancer
mna05202  Transcriptional misregulation in cancer
mna05205  Proteoglycans in cancer
mna05214  Glioma
mna05215  Prostate cancer
mna05218  Melanoma
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107527774 (IGF1R)
   04014 Ras signaling pathway
    107527774 (IGF1R)
   04015 Rap1 signaling pathway
    107527774 (IGF1R)
   04066 HIF-1 signaling pathway
    107527774 (IGF1R)
   04068 FoxO signaling pathway
    107527774 (IGF1R)
   04151 PI3K-Akt signaling pathway
    107527774 (IGF1R)
   04152 AMPK signaling pathway
    107527774 (IGF1R)
   04150 mTOR signaling pathway
    107527774 (IGF1R)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107527774 (IGF1R)
   04140 Autophagy - animal
    107527774 (IGF1R)
  09143 Cell growth and death
   04114 Oocyte meiosis
    107527774 (IGF1R)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107527774 (IGF1R)
   04520 Adherens junction
    107527774 (IGF1R)
   04550 Signaling pathways regulating pluripotency of stem cells
    107527774 (IGF1R)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    107527774 (IGF1R)
   04914 Progesterone-mediated oocyte maturation
    107527774 (IGF1R)
  09156 Nervous system
   04730 Long-term depression
    107527774 (IGF1R)
  09149 Aging
   04211 Longevity regulating pathway
    107527774 (IGF1R)
   04213 Longevity regulating pathway - multiple species
    107527774 (IGF1R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107527774 (IGF1R)
   05202 Transcriptional misregulation in cancer
    107527774 (IGF1R)
   05205 Proteoglycans in cancer
    107527774 (IGF1R)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107527774 (IGF1R)
   05214 Glioma
    107527774 (IGF1R)
   05218 Melanoma
    107527774 (IGF1R)
   05215 Prostate cancer
    107527774 (IGF1R)
   05224 Breast cancer
    107527774 (IGF1R)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107527774 (IGF1R)
   01522 Endocrine resistance
    107527774 (IGF1R)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107527774 (IGF1R)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mna04090]
    107527774 (IGF1R)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     107527774 (IGF1R)
Protein kinases [BR:mna01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   107527774 (IGF1R)
CD molecules [BR:mna04090]
 Proteins
  107527774 (IGF1R)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain Pkinase Furin-like fn3 Insulin_TMD B2 Kinase-like
Other DBs
NCBI-GeneID: 107527774
NCBI-ProteinID: XP_016056091
LinkDB
Position
Unknown
AA seq 1376 aa
MKSGSGGGSLTSLWGLLFVVATLSLWPTSGEICGPGIDIRNDYQQLRRLENCTVIEGYLH
ILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIF
EMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAVSNNYVAGNKSPKECGD
LCPGALEGKPTCERTTINNEYNYRCWTANHCQKSKTCPSACGKRACTENNECCHPECLGS
CNAPDDDAACVACRHYYFEGVCVPSCPPNTYRFEGWRCVDRDFCANIPNAEGADVEGFVI
HDGECMQECPSGFIRNDSESMFCVPCEGPCPKVCEEEKRTKTIDSVTSAQMLQGCTIFKG
NLLINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRQILGEEQLEGNY
SFYVLDNQNLQQLWDWDHRNLTIKSGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDIN
TRNNGERASCESDVLHFTSTNTWKNRIILTWRRYRPPDYRDLISFTVYYKEAPFKNVTEY
DGQDACGSNSWNMVDVDLPSNKDLEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAK
SEILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQQQPQDSYLY
RHNYCSKDKIPVRKYAGGTFDIEEVTENPKTEVCGGEKGPCCACPKTEAEKQAEKEEAEY
RKVFENFLHNSIFVPRPERKRRDLGQVANATVSSRGRNSTVADSYNATDTDDLETEYPFF
ESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPV
TWEPRPENSIFLKWSEPENPNGLILMYEIKYGSQIEDQRECVPRQEYRKLGGAKLNRLNP
GNYTARIQATSLSGNGSWTEPVFFYVQAKTTYEGFTHLVIALPVAIVLIVGGLVIMLYVF
HRKRNGGRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITMNRELGQGSFGMVYEGVA
KGVVKDEPETRVAIKTVNESASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVI
MELMTRGDLKSYLRSLRPELERNPSLSPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAA
RNCMVAEDLTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWSF
GVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMHVCWQYNPKMRPS
FLDIIGSIKDEMEPSFVEVSFYYSDENKPPEVEEEMEMEMEMEPDNMESVPLDPSASCAS
LPLPERHPVYKVENGPGPGPGMLAFRASFDERQPYAHMNGGRKNERPVPLPQSSTC
NT seq 4131 nt   +upstreamnt  +downstreamnt
atgaagtctggttccggaggagggtccctgacctccctgtgggggctcctgtttgtcgtc
gccacgctctcgctctggcccacgagtggagaaatctgcggccccggcatcgacatccgc
aatgactaccagcagctgaggcgcctggagaactgcacggtgatcgagggctacctgcac
atcctgctcatctccaaggcggaggactatcgcagctaccgcttccccaagctcacggtc
atcaccgagtacctgctgctgttccgcgtggccggcctcgagagcctgggcgacctgttc
cccaacctcacggtcatccgcggctggaagctcttctacaactacgccctggtcatcttc
gagatgaccaacctcaaggacatcgggctttacaacctgaggaacatcacccggggcgcc
atccgcatcgagaagaatgccgacctctgctatctgtccaccgtggactggtccctgatc
ctggacgccgtgtccaacaactacgtcgcggggaacaagtccccgaaggagtgcggggac
ctgtgcccaggggcgctggaggggaagcccacgtgcgagaggaccaccatcaacaacgaa
tacaactaccgatgctggaccgcgaatcactgccagaaaagtaagacgtgcccgagcgcg
tgcgggaagcgagcgtgcaccgagaacaacgaatgctgccaccccgagtgcctgggcagc
tgcaatgcccccgacgacgacgcagcctgcgtggcctgccgacactactactttgagggc
gtctgtgtacccagctgcccacccaacacctaccgcttcgagggctggcgctgcgtggac
cgcgacttctgtgccaacatccccaacgccgagggcgccgacgtggagggcttcgtgatc
cacgacggggaatgcatgcaggagtgcccctcaggcttcatccgcaacgacagcgagagc
atgttctgcgtcccctgtgagggtccttgccccaaagtctgcgaggaggaaaagagaacc
aagaccatcgactcggtgacctcggctcagatgctccagggctgcaccatcttcaagggc
aatttgctaatcaacatccgccggggcaataacatcgcctcagagctggagaacttcatg
gggctcatcgaggtggtgacgggctacgtgaagatccgccattcccacgccctggtctcc
ctgtccttcctcaaaaaccttcgccagatcttaggagaggagcagctcgaggggaattac
tccttctacgtcctggacaaccagaacctgcagcagctgtgggactgggaccaccgcaac
ctgaccatcaaatccgggaagatgtacttcgctttcaatcccaaactgtgcgtctctgag
atttaccgcatggaggaagtgacggggacaaaggggcgccagagcaaaggagatataaac
accaggaacaacggagagagagcctcctgtgagagcgacgtcctgcacttcacctccacc
aacacctggaagaaccgcatcatcctcacttggcgccggtaccggcccccggactacagg
gacctcatcagcttcaccgtctactacaaggaggcaccctttaagaacgtcaccgaatat
gacggtcaggacgcctgcggctccaacagctggaacatggtggatgtggacctgccctcc
aacaaggacctcgagcccggcatcctgctgcacgggctgaagccctggacgcagtacgcg
gtgtacgtgaaggcggtgaccctgaccatggtggaaaacgaccacatccgcggggccaag
agcgaaatcttgtacattcgcacgaatgcttcagttccttccattcccctcgacgtcctc
tccgcgtccaactcctcctcccagctgatcgtgaagtggaacccgccctccctgcccaac
ggcaacctgagctactacatcgtccggtggcagcagcagccccaggacagctacctgtat
cggcacaattactgctccaaagacaaaatccctgtccggaaatatgccggcggcaccttc
gacatcgaggaggtgacagagaaccccaagaccgaagtgtgcggcggagagaagggaccc
tgctgcgcgtgtccgaaaaccgaggcggagaagcaggccgagaaggaggaggccgagtac
cgcaaagtcttcgagaactttctgcacaactccatctttgtgcccagacctgagaggaag
cggagggaccttggacaagttgccaacgccaccgtgtccagccggggcaggaacagcacg
gtggcggacagctacaacgccacggacacggacgacctggagacggaataccccttcttt
gagagcagggtggacaacaaggagagaacggtcatttctaacctccggccgttcactctg
taccgcatcgacatccacagctgtaaccacgaggccgagaagctgggctgcagcgcctcc
aacttcgtctttgcgagaaccatgcctgcagaaggagcagatgacattcctgggccggtg
acctgggagccgaggcctgaaaactccatctttttaaagtggtcggaacctgagaatccc
aacggactgattctcatgtacgaaataaaatatggatcacagatcgaggaccagcgggag
tgcgtgcccaggcaggagtacaggaagctcggcggggccaagctgaaccggctcaacccg
ggcaactacacggcgcgcatccaggccacctctctgtctgggaacgggtcgtggacggag
cccgtgttcttctacgtccaggccaaaacgacctacgagggtttcacacacctggtcatc
gcgctcccggtggccatcgtcctgatagtgggggggctggtcatcatgctttacgtcttc
cacaggaagaggaacggcggcaggctgggcaacggagtcctgtacgcgtccgtgaacccc
gagtatttcagcgcggccgacgtgtacgtgcccgacgagtgggaggtggcccgggagaag
atcaccatgaaccgggagctggggcagggctccttcgggatggtgtacgaaggagttgcc
aagggcgtggtgaaggatgagcccgagacccgggtggccattaagacggtcaacgagtcg
gcgagcatgcgtgagaggatcgaatttctcaatgaggcttcggtgatgaaggagttcaac
tgtcaccacgtggtgcgcttgctgggcgtggtgtcccagggccagccgaccctggtcatc
atggagctcatgactcggggtgatctcaaaagttatctccggtccctgcgtccagaactg
gagagaaacccctccctctcacctcctagcctgagcaagatgatccagatggccggcgag
attgcagatggcatggcgtacctcaatgccaacaagttcgtccacagagaccttgctgcc
cggaactgcatggtggccgaagatttgactgtcaaaatcggagatttcggcatgaccagg
gacatctacgagaccgactattaccggaagggagggaagggcctgctgcctgtgcgctgg
atgtcccccgagtccctgaaggatggcgtgttcaccactcactccgacgtctggtccttt
ggagtcgtcctctgggagattgccacgctggccgagcagccgtaccagggcctgtccaac
gagcaagtcctgcgcttcgttatggagggtggccttctggacaagccggacaactgcccc
gacatgctgtttgaactcatgcacgtgtgctggcaatacaaccccaagatgaggccttcc
ttcctggacatcatcggcagcatcaaagacgagatggagcctagtttcgtcgaggtctcc
ttctactacagtgacgagaacaagccgcccgaggtcgaggaggagatggagatggagatg
gagatggagcccgacaacatggagagcgtgcccctcgacccctcggcctcctgcgcctcc
ctgcccctgcccgagcgacaccccgtgtacaaggtggagaacggccccggccccggcccg
ggcatgctggccttccgggccagcttcgacgagagacagccgtacgcgcacatgaatggc
gggcgcaagaatgagaggcccgtgcccctgccccagtcttcgacctgctga

DBGET integrated database retrieval system