KEGG   Miniopterus natalensis: 107527777
Entry
107527777         CDS       T05883                                 

Gene name
BCL2L1
Definition
(RefSeq) bcl-2-like protein 1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
mna  Miniopterus natalensis
Pathway
mna01521  EGFR tyrosine kinase inhibitor resistance
mna01524  Platinum drug resistance
mna04014  Ras signaling pathway
mna04064  NF-kappa B signaling pathway
mna04115  p53 signaling pathway
mna04137  Mitophagy - animal
mna04140  Autophagy - animal
mna04151  PI3K-Akt signaling pathway
mna04210  Apoptosis
mna04215  Apoptosis - multiple species
mna04621  NOD-like receptor signaling pathway
mna04630  JAK-STAT signaling pathway
mna05012  Parkinson disease
mna05014  Amyotrophic lateral sclerosis
mna05022  Pathways of neurodegeneration - multiple diseases
mna05145  Toxoplasmosis
mna05162  Measles
mna05166  Human T-cell leukemia virus 1 infection
mna05168  Herpes simplex virus 1 infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
mna05202  Transcriptional misregulation in cancer
mna05212  Pancreatic cancer
mna05220  Chronic myeloid leukemia
mna05222  Small cell lung cancer
mna05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107527777 (BCL2L1)
   04630 JAK-STAT signaling pathway
    107527777 (BCL2L1)
   04064 NF-kappa B signaling pathway
    107527777 (BCL2L1)
   04151 PI3K-Akt signaling pathway
    107527777 (BCL2L1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107527777 (BCL2L1)
   04137 Mitophagy - animal
    107527777 (BCL2L1)
  09143 Cell growth and death
   04210 Apoptosis
    107527777 (BCL2L1)
   04215 Apoptosis - multiple species
    107527777 (BCL2L1)
   04115 p53 signaling pathway
    107527777 (BCL2L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107527777 (BCL2L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107527777 (BCL2L1)
   05202 Transcriptional misregulation in cancer
    107527777 (BCL2L1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    107527777 (BCL2L1)
   05225 Hepatocellular carcinoma
    107527777 (BCL2L1)
   05220 Chronic myeloid leukemia
    107527777 (BCL2L1)
   05222 Small cell lung cancer
    107527777 (BCL2L1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    107527777 (BCL2L1)
   05014 Amyotrophic lateral sclerosis
    107527777 (BCL2L1)
   05022 Pathways of neurodegeneration - multiple diseases
    107527777 (BCL2L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107527777 (BCL2L1)
   05170 Human immunodeficiency virus 1 infection
    107527777 (BCL2L1)
   05162 Measles
    107527777 (BCL2L1)
   05168 Herpes simplex virus 1 infection
    107527777 (BCL2L1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107527777 (BCL2L1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107527777 (BCL2L1)
   01524 Platinum drug resistance
    107527777 (BCL2L1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107527777 (BCL2L1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107527777 (BCL2L1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107527777 (BCL2L1)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107527777 (BCL2L1)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    107527777 (BCL2L1)
Transporters [BR:mna02000]
 Other transporters
  Pores ion channels [TC:1]
   107527777 (BCL2L1)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 107527777
NCBI-ProteinID: XP_016056095
LinkDB
Position
Unknown
AA seq 233 aa
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEVPEGTESEMETPSAVNGNPSWHLV
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
NT seq 702 nt   +upstreamnt  +downstreamnt
atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa
ggatacagctggagtcagtttagtgatgtggaagagaacagaactgaagtcccagaaggg
actgaatcggagatggagacccccagtgccgtcaatggcaacccgtcctggcacctggtg
gacagccccgctgtgaatggagccactggccacagcagtagcttggatgcccgggaggtg
atccccatggcagcggtgaagcaagctctgagggaggcgggcgatgagtttgaactgagg
tatcggcgggcattcagtgacctgacgtctcagctccacatcaccccagggacagcatat
cagagctttgagcaagtagtcaatgaactcttccgggatggggtgaactggggtcgcatt
gtggcctttttctccttcggcggggcactatgtgtggaaagcgtagacaaggagatgcag
gtattggtgagtcggatcgcaacttggatggccacttacctgaatgaccacctagagcct
tggatccaggagaacggcggctgggacacttttgtggaactctacgggaacaatgctgcg
gccgagagccggaagggccaggagcgcttcaaccgctggttcctgacgggcatgactgtg
gctggcgtggttctactgggctcactcttcagtcggaaatga

DBGET integrated database retrieval system