KEGG   Miniopterus natalensis: 107527815
Entry
107527815         CDS       T05883                                 

Gene name
OPRM1
Definition
(RefSeq) mu-type opioid receptor
  KO
K04215  mu-type opioid receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04080  Neuroactive ligand-receptor interaction
mna04915  Estrogen signaling pathway
mna05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107527815 (OPRM1)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107527815 (OPRM1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107527815 (OPRM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107527815 (OPRM1)
G protein-coupled receptors [BR:mna04030]
 Rhodopsin family
  Peptide
   Opioid
    107527815 (OPRM1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx DUF2824
Other DBs
NCBI-GeneID: 107527815
NCBI-ProteinID: XP_016056155
LinkDB
Position
Unknown
AA seq 334 aa
MVTAVTIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQ
SINYLMGTWPFGTILCKMVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNA
KIINVCNWILSSAIGLPVMFMATTKYRHGSIDCTLTFSHPAWYWENLLKICVFIFAFVMP
VLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKA
LITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPPPSTVPQQGSA
RRRQSAREQPSTANTVDRTTHQLENLEAETAPLP
NT seq 1005 nt   +upstreamnt  +downstreamnt
atggtcacggccgtcaccatcatggccctctactccatcgtgtgtgtggtgggtctcttt
ggaaacttcctggtcatgtatgtgattgtcagatacaccaaaatgaagactgccaccaat
atctacatcttcaaccttgctctggcagatgccttggccaccagcacgctgccgttccag
agtatcaattacctcatgggaacgtggccctttggaaccatcctctgcaagatggtgatc
tccatagattactacaacatgttcaccagcatattcaccctctgcaccatgagcgtggac
cgctacatcgcagtctgccaccccgtcaaggccctagacttccgtaccccccgcaatgcc
aaaatcatcaacgtctgcaactggatcctctcctcggccattggcctgcctgtgatgttc
atggcaacaaccaagtacaggcatgggtccatagactgcacgctaaccttctctcaccca
gcctggtactgggaaaacctgctgaagatctgcgtgttcatcttcgccttcgtcatgccg
gtgctcatcatcacggtgtgctacggcctcatgatcttacgcctcaagagcgtccggatg
ctctctggctccaaagaaaaagacaggaaccttcgaagaatcaccaggatggtgctggtg
gtcgtggccgtgttcattgtctgctggacccccattcacatctacgtgatcatcaaagcc
ttgatcacgatcccagaaacgactttccagaccgtctcctggcacttctgcatcgctctg
ggctacaccaacagctgcctgaacccggtgctctacgcatttctggacgagaacttcaag
cgatgcttcagagagttctgcatcccaccgccctccaccgtcccgcagcagggctcggcc
cgaaggcgccagagcgccagggagcagccctccacggccaacacagtggacaggaccacc
caccagctggaaaatctggaagcagaaactgctccattgccctaa

DBGET integrated database retrieval system