KEGG   Miniopterus natalensis: 107527851
Entry
107527851         CDS       T05883                                 

Gene name
CAMK2D
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit delta isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
mna  Miniopterus natalensis
Pathway
mna04012  ErbB signaling pathway
mna04020  Calcium signaling pathway
mna04024  cAMP signaling pathway
mna04066  HIF-1 signaling pathway
mna04114  Oocyte meiosis
mna04217  Necroptosis
mna04261  Adrenergic signaling in cardiomyocytes
mna04310  Wnt signaling pathway
mna04360  Axon guidance
mna04713  Circadian entrainment
mna04720  Long-term potentiation
mna04722  Neurotrophin signaling pathway
mna04725  Cholinergic synapse
mna04728  Dopaminergic synapse
mna04740  Olfactory transduction
mna04750  Inflammatory mediator regulation of TRP channels
mna04911  Insulin secretion
mna04912  GnRH signaling pathway
mna04916  Melanogenesis
mna04921  Oxytocin signaling pathway
mna04922  Glucagon signaling pathway
mna04925  Aldosterone synthesis and secretion
mna04934  Cushing syndrome
mna04971  Gastric acid secretion
mna05012  Parkinson disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05031  Amphetamine addiction
mna05152  Tuberculosis
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05214  Glioma
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107527851 (CAMK2D)
   04310 Wnt signaling pathway
    107527851 (CAMK2D)
   04066 HIF-1 signaling pathway
    107527851 (CAMK2D)
   04020 Calcium signaling pathway
    107527851 (CAMK2D)
   04024 cAMP signaling pathway
    107527851 (CAMK2D)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107527851 (CAMK2D)
   04217 Necroptosis
    107527851 (CAMK2D)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107527851 (CAMK2D)
   04922 Glucagon signaling pathway
    107527851 (CAMK2D)
   04912 GnRH signaling pathway
    107527851 (CAMK2D)
   04921 Oxytocin signaling pathway
    107527851 (CAMK2D)
   04916 Melanogenesis
    107527851 (CAMK2D)
   04925 Aldosterone synthesis and secretion
    107527851 (CAMK2D)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107527851 (CAMK2D)
  09154 Digestive system
   04971 Gastric acid secretion
    107527851 (CAMK2D)
  09156 Nervous system
   04725 Cholinergic synapse
    107527851 (CAMK2D)
   04728 Dopaminergic synapse
    107527851 (CAMK2D)
   04720 Long-term potentiation
    107527851 (CAMK2D)
   04722 Neurotrophin signaling pathway
    107527851 (CAMK2D)
  09157 Sensory system
   04740 Olfactory transduction
    107527851 (CAMK2D)
   04750 Inflammatory mediator regulation of TRP channels
    107527851 (CAMK2D)
  09158 Development and regeneration
   04360 Axon guidance
    107527851 (CAMK2D)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107527851 (CAMK2D)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107527851 (CAMK2D)
   05205 Proteoglycans in cancer
    107527851 (CAMK2D)
  09162 Cancer: specific types
   05214 Glioma
    107527851 (CAMK2D)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    107527851 (CAMK2D)
   05022 Pathways of neurodegeneration - multiple diseases
    107527851 (CAMK2D)
  09165 Substance dependence
   05031 Amphetamine addiction
    107527851 (CAMK2D)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107527851 (CAMK2D)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107527851 (CAMK2D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107527851 (CAMK2D)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     107527851 (CAMK2D)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   107527851 (CAMK2D)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 Pkinase_fungal Kdo SnoaL_2 SnoaL_4 DUF4915
Other DBs
NCBI-GeneID: 107527851
NCBI-ProteinID: XP_016056199
LinkDB
Position
Unknown
AA seq 481 aa
MKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVFD
LVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGA
AVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKDPYGKPVDMWACGVILYILLVGY
PPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHPW
ICQRSTVASMMHRQETVDCLKKFNARRKLKGAILTTMLATRNFSAAKSLLKKPDGVKINN
RANVVTSPKENAPAPALEPQTTVIHNPDGNKESTESSNTTIEDEDIKARKQEIIKVTEQL
IEAINNGDFEAYTKICDPGLTAFEPEALGNLVEGMDFHRFYFENGLSKTNKPIHTIILNP
HVHLVGDDAACIAYIRLTQYMDGGGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPT
N
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaaaatccctactggtcaagaatatgctgccaagatcatcaacaccaagaagctttct
gccagggatcatcagaaactggaacgggaagctagaatctgccgtcttctgaagcacccc
aatattgtgcggctgcacgacagcatatcggaggagggcttccactacttggtgtttgac
ttggttactggaggtgaactgtttgaagacattgtggcaagagagtactacagcgaggcc
gacgccagccactgcatacagcagatcctagagagtgtgaaccactgtcacctgaacggc
atagttcacagggacctgaagcccgagaacttgctgttagccagcaagtccaaaggagcg
gctgtgaaactggcggacttcggcttagccatagaagttcaaggagaccagcaggcgtgg
ttcggtttcgctggcacacctgggtacctttctccagaggttttgcgcaaagacccgtat
ggaaagccggtggacatgtgggcctgcggtgtcattctgtacatcctgctggtggggtac
cccccgttctgggacgaagaccagcacagactctaccagcagatcaaggctggagcttac
gactttccatcaccagagtgggacacagtgactcctgaagccaaagacctcatcaacaaa
atgctgaccatcaaccccgccaagcgcatcacggcctccgaggcgctgaagcacccgtgg
atctgccaacgctccacggtggcctccatgatgcacagacaggagacggtggactgcctg
aagaagttcaacgcccggagaaagctgaagggtgccatcctgaccaccatgctggccacg
aggaatttttcagcggccaagagcttgctgaagaaaccagatggtgtgaagataaacaac
agagccaacgtggtaactagccccaaagagaacgcccccgccccggcgctggagccccaa
actaccgtcatccacaaccctgacggaaacaaggaatccacggagagttccaacactacg
atcgaggatgaagacatcaaagctcggaagcaggagatcatcaaagtcaccgagcagctg
atcgaagccatcaacaacggagactttgaggcgtacacaaaaatctgtgacccgggcctc
actgcttttgaacctgaagcactaggcaacttagtggaaggaatggacttccatcgattc
tactttgaaaatggtttatccaagaccaataaaccaatccacaccatcatcctgaacccc
cacgtgcacctggtgggtgacgacgccgcctgcatcgcctacatccggctcacccagtac
atggacggcggcgggatgcccaagaccatgcagtcagaggagacgcgcgtgtggcaccgc
cgggacgggaagtggcagaacgtgcacttccatcgctcggggtcacccacagtgcccacc
aactaa

KEGG   Miniopterus natalensis: 107535228
Entry
107535228         CDS       T05883                                 

Gene name
CAMK2A
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit alpha isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
mna  Miniopterus natalensis
Pathway
mna04012  ErbB signaling pathway
mna04020  Calcium signaling pathway
mna04024  cAMP signaling pathway
mna04066  HIF-1 signaling pathway
mna04114  Oocyte meiosis
mna04217  Necroptosis
mna04261  Adrenergic signaling in cardiomyocytes
mna04310  Wnt signaling pathway
mna04360  Axon guidance
mna04713  Circadian entrainment
mna04720  Long-term potentiation
mna04722  Neurotrophin signaling pathway
mna04725  Cholinergic synapse
mna04728  Dopaminergic synapse
mna04740  Olfactory transduction
mna04750  Inflammatory mediator regulation of TRP channels
mna04911  Insulin secretion
mna04912  GnRH signaling pathway
mna04916  Melanogenesis
mna04921  Oxytocin signaling pathway
mna04922  Glucagon signaling pathway
mna04925  Aldosterone synthesis and secretion
mna04934  Cushing syndrome
mna04971  Gastric acid secretion
mna05012  Parkinson disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05031  Amphetamine addiction
mna05152  Tuberculosis
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05214  Glioma
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107535228 (CAMK2A)
   04310 Wnt signaling pathway
    107535228 (CAMK2A)
   04066 HIF-1 signaling pathway
    107535228 (CAMK2A)
   04020 Calcium signaling pathway
    107535228 (CAMK2A)
   04024 cAMP signaling pathway
    107535228 (CAMK2A)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107535228 (CAMK2A)
   04217 Necroptosis
    107535228 (CAMK2A)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107535228 (CAMK2A)
   04922 Glucagon signaling pathway
    107535228 (CAMK2A)
   04912 GnRH signaling pathway
    107535228 (CAMK2A)
   04921 Oxytocin signaling pathway
    107535228 (CAMK2A)
   04916 Melanogenesis
    107535228 (CAMK2A)
   04925 Aldosterone synthesis and secretion
    107535228 (CAMK2A)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107535228 (CAMK2A)
  09154 Digestive system
   04971 Gastric acid secretion
    107535228 (CAMK2A)
  09156 Nervous system
   04725 Cholinergic synapse
    107535228 (CAMK2A)
   04728 Dopaminergic synapse
    107535228 (CAMK2A)
   04720 Long-term potentiation
    107535228 (CAMK2A)
   04722 Neurotrophin signaling pathway
    107535228 (CAMK2A)
  09157 Sensory system
   04740 Olfactory transduction
    107535228 (CAMK2A)
   04750 Inflammatory mediator regulation of TRP channels
    107535228 (CAMK2A)
  09158 Development and regeneration
   04360 Axon guidance
    107535228 (CAMK2A)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107535228 (CAMK2A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107535228 (CAMK2A)
   05205 Proteoglycans in cancer
    107535228 (CAMK2A)
  09162 Cancer: specific types
   05214 Glioma
    107535228 (CAMK2A)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    107535228 (CAMK2A)
   05022 Pathways of neurodegeneration - multiple diseases
    107535228 (CAMK2A)
  09165 Substance dependence
   05031 Amphetamine addiction
    107535228 (CAMK2A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107535228 (CAMK2A)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107535228 (CAMK2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107535228 (CAMK2A)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     107535228 (CAMK2A)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   107535228 (CAMK2A)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr SnoaL_3 DUF4440 APH Kdo SnoaL_2 SnoaL_4
Other DBs
NCBI-GeneID: 107535228
NCBI-ProteinID: XP_016066084
LinkDB
Position
Unknown
AA seq 489 aa
MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLERE
ARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYL
SPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV
TPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK
GAILTTMLATRNFSGGKSGGNKKNDGVKKRKSSSSVQLMESSESTNTTIEDEDTKVRKQE
IIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKP
VHTTILNPHIHLMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHR
SGAPSVLPH
NT seq 1470 nt   +upstreamnt  +downstreamnt
atggccaccatcacctgcacccgattcacggaagagtaccagctctttgaggaactggga
aagggagccttctcggtggttcgcaggtgcgtgaaggtgttggctggccaggagtatgct
gccaagatcatcaacaccaagaaactctctgccagagaccatcagaagctggagcgtgaa
gcccgcatctgccgtctactgaagcaccccaacatcgtccggctccacgacagcatctct
gaggagggacaccattacctgatcttcgacctggtcaccggtggggagctgtttgaggac
atcgtggcccgggagtattacagtgaggctgatgccagtcactgtatccagcagatcctg
gaggccgtgctgcactgccaccagatgggagtggtgcaccgggacctgaagccggagaat
ctgctgctggcctccaagctcaagggcgctgcggtgaagctggcggactttggcctggcc
atagaggtggagggggagcagcaggcatggtttgggttcgcagggacacctggatacctc
tctccagaagtgctgcggaaggacccgtatgggaagcctgtggatctgtgggcctgcggg
gtcatcctgtacatcctgctagttgggtatcccccattctgggatgaagaccagcaccgc
ttgtaccagcagatcaaagccggcgcctatgatttcccatcaccagagtgggacaccgtg
accccagaagccaaggatctgatcaataagatgctgaccatcaacccatccaaacgcatc
acggctgctgaggccctcaagcacccctggatctcgcaccggtccaccgtggcgtcctgc
atgcacagacaggagaccgtggactgcctgaagaagttcaacgccaggagaaaactgaag
ggagctatcctcaccacgatgctggccaccaggaacttctctggagggaagagtggggga
aacaagaagaatgatggtgtgaagaaaagaaagtccagttccagcgttcagttaatggaa
tcttcagagagcaccaacaccaccattgaggacgaagacaccaaagtgcggaaacaggaa
attataaaagtgacagagcagctgattgaagccataagcaatggagattttgagtcctac
acgaagatgtgtgaccccgggatgacagccttcgaacccgaggccctggggaacctggtc
gagggcctggacttccatcgattctattttgaaaacctgtggtcccggaacagcaagcct
gtgcacaccaccattttgaacccccacatccacctgatgggcgacgagtcggcctgcatc
gcctacattcgtatcacacagtacctggacgctggtggcatcccccgcacggcccagtcg
gaggagacccgcgtctggcaccgccgggacggcaaatggcagatcgtccacttccacaga
tctggggcgccctctgtcctgccccattga

KEGG   Miniopterus natalensis: 107542053
Entry
107542053         CDS       T05883                                 

Gene name
CAMK2B
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit beta
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
mna  Miniopterus natalensis
Pathway
mna04012  ErbB signaling pathway
mna04020  Calcium signaling pathway
mna04024  cAMP signaling pathway
mna04066  HIF-1 signaling pathway
mna04114  Oocyte meiosis
mna04217  Necroptosis
mna04261  Adrenergic signaling in cardiomyocytes
mna04310  Wnt signaling pathway
mna04360  Axon guidance
mna04713  Circadian entrainment
mna04720  Long-term potentiation
mna04722  Neurotrophin signaling pathway
mna04725  Cholinergic synapse
mna04728  Dopaminergic synapse
mna04740  Olfactory transduction
mna04750  Inflammatory mediator regulation of TRP channels
mna04911  Insulin secretion
mna04912  GnRH signaling pathway
mna04916  Melanogenesis
mna04921  Oxytocin signaling pathway
mna04922  Glucagon signaling pathway
mna04925  Aldosterone synthesis and secretion
mna04934  Cushing syndrome
mna04971  Gastric acid secretion
mna05012  Parkinson disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05031  Amphetamine addiction
mna05152  Tuberculosis
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05214  Glioma
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107542053 (CAMK2B)
   04310 Wnt signaling pathway
    107542053 (CAMK2B)
   04066 HIF-1 signaling pathway
    107542053 (CAMK2B)
   04020 Calcium signaling pathway
    107542053 (CAMK2B)
   04024 cAMP signaling pathway
    107542053 (CAMK2B)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107542053 (CAMK2B)
   04217 Necroptosis
    107542053 (CAMK2B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107542053 (CAMK2B)
   04922 Glucagon signaling pathway
    107542053 (CAMK2B)
   04912 GnRH signaling pathway
    107542053 (CAMK2B)
   04921 Oxytocin signaling pathway
    107542053 (CAMK2B)
   04916 Melanogenesis
    107542053 (CAMK2B)
   04925 Aldosterone synthesis and secretion
    107542053 (CAMK2B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107542053 (CAMK2B)
  09154 Digestive system
   04971 Gastric acid secretion
    107542053 (CAMK2B)
  09156 Nervous system
   04725 Cholinergic synapse
    107542053 (CAMK2B)
   04728 Dopaminergic synapse
    107542053 (CAMK2B)
   04720 Long-term potentiation
    107542053 (CAMK2B)
   04722 Neurotrophin signaling pathway
    107542053 (CAMK2B)
  09157 Sensory system
   04740 Olfactory transduction
    107542053 (CAMK2B)
   04750 Inflammatory mediator regulation of TRP channels
    107542053 (CAMK2B)
  09158 Development and regeneration
   04360 Axon guidance
    107542053 (CAMK2B)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107542053 (CAMK2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107542053 (CAMK2B)
   05205 Proteoglycans in cancer
    107542053 (CAMK2B)
  09162 Cancer: specific types
   05214 Glioma
    107542053 (CAMK2B)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    107542053 (CAMK2B)
   05022 Pathways of neurodegeneration - multiple diseases
    107542053 (CAMK2B)
  09165 Substance dependence
   05031 Amphetamine addiction
    107542053 (CAMK2B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107542053 (CAMK2B)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107542053 (CAMK2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107542053 (CAMK2B)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     107542053 (CAMK2B)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   107542053 (CAMK2B)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 SnoaL_2 APH Kdo Pkinase_fungal SnoaL_4
Other DBs
NCBI-GeneID: 107542053
NCBI-ProteinID: XP_016074740
LinkDB
Position
Unknown
AA seq 547 aa
MAVVGRKSAPYRPFRLRLQLRFLNRPRGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDH
QKLEREARICRLLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASH
CIQQILEAVLHCHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFA
GTPGYLSPEVLRKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPS
PEWDTVTPEAKNLINQMLTINPAKRITAHEALKHPWVCQRSTVASMMHRQETVECLKKFN
ARRKLKGAILTTMLATRNFSVGRQTTAPATMSTAASGTTMGLVEQAKSMLNKKADGVKPQ
TNSTKNSSAATSPKGTLPPAALEPQTTVIHNPVDGIKDSPDSTHTTIEDEDTKARKQEII
KITEQLIEAVNNGDFEAYAKICDPGLTSFEPEALGNLVEGMDFHRFYFENLLAKNSKPIH
TTILNPHVHVIGEDAACIAYVRLTQYIDGQGRPRTSQSEETRVWHRRDGKWQNVHFHCSG
APVAPLQ
NT seq 1644 nt   +upstreamnt  +downstreamnt
atggcagtggtggggcgcaagagcgccccctacaggcccttccgactccggctgcagttg
aggttccttaaccgtcccaggggggcgttctctgtggtccgacgctgtgtcaagctctgc
accggccacgagtatgcagccaagatcatcaacaccaagaagctgtctgccagagatcac
cagaagctggagagagaggctcgaatctgtcgccttctgaagcactccaacatagtgcgt
ctgcacgacagcatctccgaggaggggttccactacctggtcttcgatctggtcactggt
ggggagctatttgaggacattgtggcgagagagtactacagcgaggcggatgccagtcac
tgcatccagcagatcctggaggcggttctccactgccaccagatgggggtcgttcacagg
gacctcaagccagagaacctgctcctggccagcaagtgcaagggggccgcagtgaagctc
gcagactttggcctggctatcgaggtgcagggggaccagcaggcatggtttgggttcgct
ggcacgccgggctacctgtctccagaggtcctgcgcaaggaagcctacggcaagccagtg
gatatctgggcatgcggggtgatcctgtacatcctgctggtgggctacccccccttctgg
gatgaagaccagcacaagctgtaccagcagatcaaggctggcgcctatgacttcccgtcc
cctgagtgggacacagtcacacccgaagccaaaaacctcatcaaccagatgctgaccatc
aaccctgccaagcgcatcactgcgcacgaggcgctgaagcatccgtgggtctgccaacgc
tccacggtggcctccatgatgcacaggcaggagacggtggagtgcctgaaaaagttcaat
gcccgaaggaagctcaagggagccatcctcaccaccatgctggccacccggaatttctca
gtgggcagacagaccaccgctccagccacaatgtccaccgcggcctccggcaccaccatg
gggctggtggaacaagccaagagtatgctcaacaagaaggcagacggagtgaagccccag
acgaatagcaccaagaacagttcagctgccaccagccccaaggggacacttcctccggct
gccctggagcctcaaaccaccgtcattcataaccctgtggacgggatcaaggactcaccc
gacagcacccacaccaccatagaagatgaggacaccaaagcgaggaagcaggagatcatc
aagatcacagagcagctcattgaggccgtcaacaacggcgacttcgaggcctacgcgaaa
atctgcgacccaggcctgacctcatttgagcctgaagctttgggcaacctggtcgaaggg
atggacttccacaggttctacttcgagaacttgctcgccaaaaacagcaaaccgatccac
acgaccatcctgaacccgcatgtgcacgtcatcggggaggacgccgcctgcatcgcctac
gtccgcctcacccagtacatcgacggccagggccggccccgcaccagccagtccgaggag
acccgcgtgtggcaccgccgcgacggcaagtggcagaatgtgcacttccactgctcgggg
gcgcccgtggccccactgcagtga

KEGG   Miniopterus natalensis: 107545830
Entry
107545830         CDS       T05883                                 

Gene name
CAMK2G
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit gamma isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
mna  Miniopterus natalensis
Pathway
mna04012  ErbB signaling pathway
mna04020  Calcium signaling pathway
mna04024  cAMP signaling pathway
mna04066  HIF-1 signaling pathway
mna04114  Oocyte meiosis
mna04217  Necroptosis
mna04261  Adrenergic signaling in cardiomyocytes
mna04310  Wnt signaling pathway
mna04360  Axon guidance
mna04713  Circadian entrainment
mna04720  Long-term potentiation
mna04722  Neurotrophin signaling pathway
mna04725  Cholinergic synapse
mna04728  Dopaminergic synapse
mna04740  Olfactory transduction
mna04750  Inflammatory mediator regulation of TRP channels
mna04911  Insulin secretion
mna04912  GnRH signaling pathway
mna04916  Melanogenesis
mna04921  Oxytocin signaling pathway
mna04922  Glucagon signaling pathway
mna04925  Aldosterone synthesis and secretion
mna04934  Cushing syndrome
mna04971  Gastric acid secretion
mna05012  Parkinson disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05031  Amphetamine addiction
mna05152  Tuberculosis
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05214  Glioma
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107545830 (CAMK2G)
   04310 Wnt signaling pathway
    107545830 (CAMK2G)
   04066 HIF-1 signaling pathway
    107545830 (CAMK2G)
   04020 Calcium signaling pathway
    107545830 (CAMK2G)
   04024 cAMP signaling pathway
    107545830 (CAMK2G)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107545830 (CAMK2G)
   04217 Necroptosis
    107545830 (CAMK2G)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107545830 (CAMK2G)
   04922 Glucagon signaling pathway
    107545830 (CAMK2G)
   04912 GnRH signaling pathway
    107545830 (CAMK2G)
   04921 Oxytocin signaling pathway
    107545830 (CAMK2G)
   04916 Melanogenesis
    107545830 (CAMK2G)
   04925 Aldosterone synthesis and secretion
    107545830 (CAMK2G)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107545830 (CAMK2G)
  09154 Digestive system
   04971 Gastric acid secretion
    107545830 (CAMK2G)
  09156 Nervous system
   04725 Cholinergic synapse
    107545830 (CAMK2G)
   04728 Dopaminergic synapse
    107545830 (CAMK2G)
   04720 Long-term potentiation
    107545830 (CAMK2G)
   04722 Neurotrophin signaling pathway
    107545830 (CAMK2G)
  09157 Sensory system
   04740 Olfactory transduction
    107545830 (CAMK2G)
   04750 Inflammatory mediator regulation of TRP channels
    107545830 (CAMK2G)
  09158 Development and regeneration
   04360 Axon guidance
    107545830 (CAMK2G)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107545830 (CAMK2G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107545830 (CAMK2G)
   05205 Proteoglycans in cancer
    107545830 (CAMK2G)
  09162 Cancer: specific types
   05214 Glioma
    107545830 (CAMK2G)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    107545830 (CAMK2G)
   05022 Pathways of neurodegeneration - multiple diseases
    107545830 (CAMK2G)
  09165 Substance dependence
   05031 Amphetamine addiction
    107545830 (CAMK2G)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107545830 (CAMK2G)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107545830 (CAMK2G)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107545830 (CAMK2G)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     107545830 (CAMK2G)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   107545830 (CAMK2G)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr SnoaL_3 DUF4440 APH Pkinase_fungal SnoaL_2 Kdo RIO1
Other DBs
NCBI-GeneID: 107545830
NCBI-ProteinID: XP_016079558
LinkDB
Position
Unknown
AA seq 577 aa
MKHACVTLLCSVSQFFPPSPSRGAFSVVRRCVKKTSTQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQI
LESVNHIHQHDIVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITADQALKHPWVCQRSTVASMMHRQETVECLRKFNARRKL
KGAILTTMLVSRNFSVGRQSSAPASPAASAAGLAGQAAKSLLNKKSDGGVKPQSNNKNSL
VSPVQEPAPLQTAMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKAAPLRTGNGSSVPEG
RSSRDRTAPSAGMQPQPSLCSSAMRKQEIIKITEQLIEAINNGDFEAYTKICDPGLTSFE
PEALGNLVEGMDFHKFYFENLLSKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQ
GRPRTSQSEETRVWHRRDGKWLNVHYHCSGAPAAPLQ
NT seq 1734 nt   +upstreamnt  +downstreamnt
atgaagcatgcttgtgttactctgctgtgctcggtgtcccagttctttcccccttctccc
tccaggggtgctttctctgtggtccgcaggtgtgtgaagaaaacctccacgcaggagtat
gcagcaaaaatcatcaataccaagaagttgtctgcccgggatcaccagaaattagaacgt
gaggcccggatatgccgacttttgaaacacccaaatatcgtgcgcctccatgacagtatt
tctgaagaagggtttcactacctcgtgtttgaccttgttactggtggagagctgtttgaa
gacattgtggccagagaatactacagtgaagctgatgccagccactgtatacatcagatt
ctggagagtgttaaccacatccaccagcacgacatcgtccacagggacctgaagcctgag
aacctgttgctggcgagtaaatgcaagggtgctgcagtcaagctggctgattttggccta
gccatagaagtacagggagaacagcaggcttggtttggttttgctggcaccccaggttac
ttgtcccctgaggtcttgaggaaagatccctatggaaaacctgtggatatctgggcctgc
ggagtcatcctgtacattctccttgtggggtacccccccttctgggatgaggatcagcat
aagctgtaccagcagatcaaggccggagcctatgatttcccatcaccagagtgggacacg
gtgacccctgaagccaagaacttgatcaaccagatgctgaccataaaccctgcaaaacgt
attacagctgaccaggctctcaagcatccatgggtctgccaacggtccacggtggcatcc
atgatgcatcgtcaggagactgtggagtgcttgcgcaagttcaatgcccggagaaaacta
aagggtgccatcctcacgaccatgcttgtttccaggaacttttcagttggcaggcagagc
tccgcccccgcctcgcctgccgcgagcgccgccggcctggccgggcaagctgccaaaagt
ctattgaacaagaagtcggatggcggtgtcaagccacagagcaacaacaaaaacagtctc
gtaagcccagtccaagagcccgcgcccttgcagacggccatggagccacaaaccaccgtg
gtgcacaacgctaccgatgggatcaagggctccacagagagctgcaacaccaccacagaa
gatgaggacctcaaagctgccccgctccgcactgggaatggcagctcggtgcctgaagga
cggagctcccgggacagaacagccccctctgcaggcatgcagccccagccttctctctgc
tcctcagccatgcgaaaacaggagatcattaagatcacagaacaactgattgaggccatc
aacaatggagattttgaggcctacacgaagatttgtgatccaggcctcacttcctttgag
cctgaagcccttggtaacctcgtggagggaatggatttccataagttttactttgagaat
ctcctgtccaagaacagcaagcccattcacaccaccatcctgaacccacacgtccatgtg
atcggagaggacgcagcttgcatcgcctacatccgcctcacccagtacatcgatgggcag
ggtcggcctcgcaccagccagtcggaggagacccgggtctggcaccgccgggatggcaag
tggctcaatgtccactatcactgctcaggggcccctgccgcaccgctgcagtga

KEGG   Miniopterus natalensis: 107546482
Entry
107546482         CDS       T05883                                 

Gene name
CAMK4
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type IV
  KO
K05869  calcium/calmodulin-dependent protein kinase IV [EC:2.7.11.17]
Organism
mna  Miniopterus natalensis
Pathway
mna04020  Calcium signaling pathway
mna04024  cAMP signaling pathway
mna04211  Longevity regulating pathway
mna04371  Apelin signaling pathway
mna04380  Osteoclast differentiation
mna04720  Long-term potentiation
mna04722  Neurotrophin signaling pathway
mna04725  Cholinergic synapse
mna04921  Oxytocin signaling pathway
mna04925  Aldosterone synthesis and secretion
mna05031  Amphetamine addiction
mna05034  Alcoholism
mna05214  Glioma
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107546482 (CAMK4)
   04020 Calcium signaling pathway
    107546482 (CAMK4)
   04024 cAMP signaling pathway
    107546482 (CAMK4)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107546482 (CAMK4)
   04925 Aldosterone synthesis and secretion
    107546482 (CAMK4)
  09156 Nervous system
   04725 Cholinergic synapse
    107546482 (CAMK4)
   04720 Long-term potentiation
    107546482 (CAMK4)
   04722 Neurotrophin signaling pathway
    107546482 (CAMK4)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107546482 (CAMK4)
  09149 Aging
   04211 Longevity regulating pathway
    107546482 (CAMK4)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    107546482 (CAMK4)
  09165 Substance dependence
   05031 Amphetamine addiction
    107546482 (CAMK4)
   05034 Alcoholism
    107546482 (CAMK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107546482 (CAMK4)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     107546482 (CAMK4)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   107546482 (CAMK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo APH Pkinase_fungal YrbL-PhoP_reg
Other DBs
NCBI-GeneID: 107546482
NCBI-ProteinID: XP_016080388
LinkDB
Position
Unknown
AA seq 636 aa
MSSDKIQSGEEASRRRLLGRGRGMWVGVIGLVGISLLLLGGGFWVVKSITNLGMANNDVS
LKITSEEILISPGPVTTTCAGCFNKLLLEEARKTPPGAPSEEFTEEPEEAELTQPPTFQC
PACECRISRGQEKGHRPSPTAQGPPWSSEPASEDSKYLPFQELRQCQRRQRQQQHRRIHS
NKRLPSKCDGISRWAFGGELGLDEVMKEGPCDRIHDLTRRNNKRGATSVVYRCKQKGTQK
PYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLELVTGGELFDRI
VEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAPLKIADFGLSK
IVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEPFYDERGDQFM
FRRILNCEYYFISPWWDEVSLNAKDLVRKLIVLDPKKRLTTFQALQHPWVTGKAANFVHM
DTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSSHSGLQEGHKAGQEPCPVQGGGEAVG
AAPEKEVPGDGAQMAVERPEAGPTEAPSSERVQEADANAAEAPEDGTEVAAPEGEEEEEG
EEELKTVTEAAAPQKGQDDPALGFGAQQNDGVLPEN
NT seq 1911 nt   +upstreamnt  +downstreamnt
atgtcgtctgacaagatccagagtggagaggaagcttcacggaggcgtcttctggggaga
ggacgtggcatgtgggtgggagtaattggcttagtgggaatatctcttctcctccttgga
gggggattttgggtcgtaaagtcaataactaacctgggaatggcaaataatgatgtgtcc
ctaaaaatcacttctgaagaaatcctgatttccccaggtccagtcactaccacatgtgct
ggatgctttaacaaattgttattagaagaagccaggaaaactccccctggcgcccccagt
gaggaatttacggaggaaccagaggaagctgagctcacgcagccgcctacgttccagtgc
ccggcctgtgagtgcaggattagtcgaggacaggaaaaaggccatcgcccctcgcctact
gcacaaggaccaccctggtcttcagagcctgcgagtgaagacagcaaatacctgcctttt
caagagcttcgacagtgccaaaggaggcagcgccagcagcagcaccgcagaatccattcc
aacaaaagacttccctcaaagtgtgatggtatttcaagatgggcctttgggggcgaatta
gggctggatgaggtcatgaaagaggggccttgtgaccgaatccatgaccttacaagaaga
aacaacaaaaggggtgctacatccgttgtgtacagatgcaaacagaaggggactcagaag
ccttatgctctcaaagtgttaaagaaaacagtggacaaaaaaatcgtgagaactgagata
ggagttctacttcgcctctcacatccgaacattataaaacttaaagagatatttgaaact
cccacagaaatcagtctggtcctagaactcgtcacaggaggagagctgtttgacaggatt
gtggaaaaggggtattacagtgaacgagatgctgcagatgctgttaaacaaatcctggag
gctgttgcttacctccatgaaaatgggattgtccatcgtgatctcaaaccagagaatctt
ctctatgcaactccagccccagatgcaccactcaaaattgctgattttggactctccaaa
attgtggaacatcaagtgctcatgaagacggtgtgtggaacgccagggtattgtgcacct
gaaattcttagaggctgcgcctacggacctgaggtggacatgtggtctgtagggataatc
acctacatcctactttgtgggtttgaaccgttctacgacgaaagaggcgatcagttcatg
ttcaggaggattctgaattgtgaatattactttatctccccctggtgggatgaagtatct
ctaaatgccaaggacttggtcagaaaattaattgtcttggatcctaagaaacgtctgact
accttccaagctctccagcacccatgggtcacaggtaaagcagccaattttgtacacatg
gatactgctcaaaagaagctccaagaattcaacgcccggcgcaagcttaaggcggcggtg
aaggccgtggtggcctcgtcgcggctgggcagtgccagcagtagccatagcggcctccag
gagggccacaaggccggccaagagccatgccccgtccaaggcggcggcgaagctgtcggc
gccgctccagagaaggaagttccaggggacggggcccagatggccgtcgagaggccggag
gccgggcccacggaggcgccgtcctcggagcgagtccaagaggccgatgcgaatgctgcc
gaggcgccggaggacgggacagaggtggcagccccagaaggagaggaggaggaggagggg
gaggaggagctgaagactgtgacggaagcagcggccccccagaaagggcaagacgaccct
gctctgggctttggggctcagcagaatgacggggtcctgccagagaactaa

DBGET integrated database retrieval system