KEGG   Miniopterus natalensis: 107527895
Entry
107527895         CDS       T05883                                 

Gene name
CDH1
Definition
(RefSeq) cadherin-1
  KO
K05689  cadherin 1, type 1, E-cadherin
Organism
mna  Miniopterus natalensis
Pathway
mna04015  Rap1 signaling pathway
mna04371  Apelin signaling pathway
mna04390  Hippo signaling pathway
mna04514  Cell adhesion molecules
mna04520  Adherens junction
mna05100  Bacterial invasion of epithelial cells
mna05200  Pathways in cancer
mna05213  Endometrial cancer
mna05216  Thyroid cancer
mna05218  Melanoma
mna05219  Bladder cancer
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107527895 (CDH1)
   04390 Hippo signaling pathway
    107527895 (CDH1)
   04371 Apelin signaling pathway
    107527895 (CDH1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107527895 (CDH1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107527895 (CDH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107527895 (CDH1)
  09162 Cancer: specific types
   05226 Gastric cancer
    107527895 (CDH1)
   05216 Thyroid cancer
    107527895 (CDH1)
   05218 Melanoma
    107527895 (CDH1)
   05219 Bladder cancer
    107527895 (CDH1)
   05213 Endometrial cancer
    107527895 (CDH1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    107527895 (CDH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107527895 (CDH1)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mna04515]
    107527895 (CDH1)
   04090 CD molecules [BR:mna04090]
    107527895 (CDH1)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    107527895 (CDH1)
Cell adhesion molecules [BR:mna04515]
 Cadherins
  Major cadherins
   107527895 (CDH1)
CD molecules [BR:mna04090]
 Proteins
  107527895 (CDH1)
SSDB
Motif
Pfam: Cadherin Cadherin_C Cadherin_pro RET_CLD1
Other DBs
NCBI-GeneID: 107527895
NCBI-ProteinID: XP_016056263
LinkDB
Position
Unknown
AA seq 886 aa
MGPPCRSLFALLLLLQVSPRLCQEPEPCRPGFGAESYAFTVPRRHLERGRVLGRVSFEGC
TGQPRTIYVSDDTRFKVGMDGVLMVRRPLQLHNPEMSFLIHAWDSTRRKLSTKVTLKAAE
HNHHRRHHHHRHHDSVPETQAEVLTFPDSHHGLRRQKRDWVIPPISCPENEKGPFPKNLV
QIKSNRDKETQVFYSITGQGADAPPVGVFIIERETGWLKVTQPLDREAIAKYILFSHAVS
SNGNAIEDPMEIVITVTDQNDNRPQFTQEVFEGSVPEGALPGTSVMQVTATDADDEVNTY
NAAIAYVILSQEPEQPHDQMFTINRDTGVISVLTTGLDREKFATYTLVIQAADLQGEGLS
TTAKAVITITDINDNPPIFDPTTYEGQVPENEANAVIATLKVTDADVPDTPAWKAMYTVL
NDEDQFVVTTDPVTNDGILKTTKGLDFETKQQYILYVAVTNEDAFVVTLSTSTATITVDV
MDVNEAPIFMPLQKRVEVSEDFPVGQEITSYTAQDPDTFMDQKITYRIWRDTANWLEINP
ETGAISSRAEMDREDFEHVKNSTYTALIIATDNGSPLATGTGTLLLILSDVNDNAPVPEP
RNLEFCQRSPQPQVINIIDPDLPPNTSPFTAELTYGSSVNWTIEYNDPEHESLILKPKKT
LELGEYKINLRLEDYQNKDQVTTLEVYVCDCEGAVTVCKRNMAYAEAGLQLPAILGILGG
ILALLILILLLLLFVRRRRVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGL
DARPEVTRNDVAPTLLSMPQYRPRPANPDEIGNFIDENLKAADSDPTAPPYDSLLVFDYE
GSGSEAASLSSLNSSESDQDQDYDYLNEWGNRFKKLADMYGGGVDD
NT seq 2661 nt   +upstreamnt  +downstreamnt
atgggccctccgtgccgcagcctcttcgcgctcctgctactgctgcaggtctcaccgagg
ctctgccaggagccggagccctgtcgtcccggctttggcgccgagagctacgcgttcacg
gtgccccggcggcacttggagaggggccgcgtcctgggcagagtgagttttgaaggatgc
accggtcaaccaaggaccatctatgtctctgatgacaccagattcaaagtgggcatggac
ggtgtgcttatggtcagacggcctttacaactgcataatccagaaatgagttttctcatt
cacgcctgggactccacccgcaggaagctctccaccaaagtgaccctgaaggcagcagag
cacaaccaccaccgccgccaccaccaccaccgtcatcatgactctgtccctgaaacccag
gcggaagtgctcacgtttcctgactcccaccatggtctcagaagacagaagagagactgg
gttatccctcccatcagctgcccagaaaatgagaaaggcccatttcctaagaatctggtt
cagatcaaatctaacagggacaaagaaacgcaggttttctacagcatcactggtcaaggg
gctgatgcaccccctgttggtgtgtttattattgaaagagaaacaggatggctaaaggtg
actcagccactggatagagaagcaattgccaagtacatcctcttctctcatgctgtgtct
tcgaatgggaatgcaattgaggatccgatggagattgtgatcacagtgacagatcagaat
gacaacaggccccagttcacccaggaggtctttgaggggtctgtcccggaaggcgctctc
ccaggaacctctgtgatgcaggtcacggccacagacgccgatgatgaagtgaacacctac
aatgccgccatcgcttacgtcatcctcagccaagagcctgagcagcctcacgaccaaatg
ttcaccatcaatagggatacaggagtcatcagcgtgctcaccaccggactggaccgtgag
aagtttgccacgtataccctggtgattcaagctgctgaccttcaaggtgaaggcttaagc
acaactgcaaaagctgtgatcacgatcactgacatcaatgacaaccctcccatctttgat
ccgactacgtacgaggggcaggttcctgagaacgaggctaatgccgtaattgctacgctc
aaagtgactgatgccgatgtccccgataccccggcgtggaaggccatgtacactgtatta
aatgacgaggaccaatttgttgtcaccacagacccagtaaccaacgacggcattttgaaa
acgactaagggcttagattttgagaccaagcagcagtacattctctacgtggcagtgaca
aatgaggatgcctttgtggtcactctgtccacttccacggccaccataactgtggatgtg
atggatgtgaacgaagcccccatcttcatgcctctccaaaaaagagtggaggtgtccgaa
gacttcccagtgggacaggaaatcacatcctacacagcccaggatccggacacattcatg
gaccagaagataacgtatcggatttggagggatacggccaactggctggagattaatcca
gagactggtgccatttccagtcgggctgagatggacagagaggactttgagcatgtgaag
aacagcacgtacacagccctcattatagctactgacaatggttctccacttgctactgga
acgggaacccttctcctgatcctctctgatgtgaatgacaatgccccagtaccagagccg
cggaatctggaattctgccagaggagtccacagcctcaagtcatcaacatcatcgatcca
gatcttccccccaacacatctcctttcacagcggagctaacatatgggtcaagcgtcaac
tggaccattgagtacaatgacccagaacatgaatctctcattttgaagccaaagaaaacc
ttagagctgggcgaatacaaaataaacctcaggcttgaagattaccagaacaaagaccag
gtgaccaccttagaagtgtatgtgtgtgactgtgaaggggccgtcacggtctgtaagagg
aacatggcttatgccgaagcaggattgcagcttcctgccatcctcgggatccttggaggc
atccttgctttgctaatcctgattctgctgcttctgctgtttgttcggaggagacgggtg
gtcaaagagcccttactgcccccagaagatgacacccgagacaatgtttattactacgat
gaagaaggaggtggagaagaggaccaggactttgacttgagccagttgcacaggggcctg
gatgctcggcctgaagtgactcgcaacgacgtggctccaacccttctaagtatgcctcag
tatcggccccgccctgccaatcctgatgaaattggaaacttcattgatgaaaatttgaag
gcggctgatagcgaccccactgctcccccttatgattccctgctcgtgtttgattacgaa
ggaagtggttccgaagctgctagtctgagctccctgaactcctcggagtcagaccaagac
caggactatgactacctgaatgaatggggcaatcgcttcaagaagctggcagatatgtac
ggaggtggcgtggatgactag

DBGET integrated database retrieval system