KEGG   Miniopterus natalensis: 107527935
Entry
107527935         CDS       T05883                                 

Gene name
SLC18A3
Definition
(RefSeq) vesicular acetylcholine transporter
  KO
K14636  MFS transporter, DHA1 family, solute carrier family 18 (vesicular acetylcholine transporter), member 3
Organism
mna  Miniopterus natalensis
Pathway
mna04721  Synaptic vesicle cycle
mna04725  Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    107527935 (SLC18A3)
   04721 Synaptic vesicle cycle
    107527935 (SLC18A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107527935 (SLC18A3)
Transporters [BR:mna02000]
 Solute carrier family (SLC)
  SLC18: Vesicular amine transporter
   107527935 (SLC18A3)
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    107527935 (SLC18A3)
SSDB
Motif
Pfam: MFS_1 Sugar_tr BT1
Other DBs
NCBI-GeneID: 107527935
NCBI-ProteinID: XP_016056326
LinkDB
Position
Unknown
AA seq 422 aa
LRPRYPTESEDVKIGVLFASKAILQLLVNPLSGTFIDRMSYDVPLLIGLGVMFASTVLFA
FAEDYATLFAARSLQGLGSAFADTSGIAMVADKYPDEPERSRALGVALAFISFGSLVAPP
FGGILYEFAGKRVPFLVLAAVSLFDAVLLLAVAKPFSAAARARANLPVGTPIHHLILDPY
IAVAAGALTACNIPLAFLEPTIATWMKHTMAASEWEMGMVWLPAFVPHVLGVYLTVRLAA
RYPHLQWLYGALGLAVVGASSCVVPACRSFAPLVVSLCGLCFGIALVDTALLPTLAFLVD
VRHVSVYGSVYAIADISYCVAYALGPIVAGHIVHSLGFGKLSLGMGLVNLLYAPVLLLLR
NVGLLTRSRSEREVLLEEPPQGLYDAMRLRECPVSDPDRAPHSPPGPFDERQDDYNDYYT
RS
NT seq 1269 nt   +upstreamnt  +downstreamnt
ctgcggccccgctaccccacggagagcgaggacgtgaagatcggggtgctgttcgcctcc
aaggccatcctgcagcttctggtgaaccccttgagcgggaccttcatcgaccgcatgagc
tacgacgtgccgctgctcatcggcctgggcgtcatgttcgcctccaccgtgctgttcgcc
ttcgccgaggactacgccacgctcttcgccgcgcgcagcctgcagggcctgggctcggcc
ttcgcggacacgtccggcatcgccatggtggccgacaaataccccgacgagcccgagcgc
agccgcgcgctgggcgtggcgctggccttcatcagcttcggaagcctcgtggcgccgccc
ttcgggggcatcctctacgaattcgcgggcaagcgcgtgcccttcctggtgctcgccgcc
gtgtcgctgtttgacgcggttctgctgctggcggtggccaagcccttctcggccgcggcg
cgggcgcgggccaacctcccggtgggcacacccatccaccacctcatcctggacccctac
atcgccgtggcggccggcgcgctcaccgcctgcaacatccccctcgctttcctcgagccc
accatcgccacgtggatgaagcacacgatggcggcgtccgagtgggagatgggcatggtc
tggctgccggcctttgtgcctcacgtgctcggcgtctacctcaccgtgcgcctcgcggcg
cgctacccacacctgcagtggctctacggcgcgctcgggctggcagtggtgggtgccagc
tcgtgcgtggtgcccgcctgtcgctccttcgcgcccctggtggtctcgctctgcggcctc
tgcttcggcatcgcgctggtggacacggctttgctgcccacgctcgccttcctcgtggac
gtgcgccacgtttcggtctacggaagcgtctacgccatcgccgacatctcctattgcgtg
gcctacgcgctcgggcccatagtggcgggccacatcgtgcattcgctcggctttgggaag
ctcagccttggcatgggtctggtcaatctgctctacgcacctgttctgctgttgctgcgc
aatgtgggcctcctgacgcggtcgcgctcggagcgcgaagtgctgctggaggagccgccg
cagggtctgtacgacgccatgcgcctgcgggagtgccccgtgtccgacccggaccgcgca
cctcacagcccgcccggcccgtttgacgagcgccaggacgactacaacgactactacacc
cgcagctag

DBGET integrated database retrieval system