KEGG   Miniopterus natalensis: 107527946
Entry
107527946         CDS       T05883                                 

Gene name
CHAT
Definition
(RefSeq) choline O-acetyltransferase
  KO
K00623  choline O-acetyltransferase [EC:2.3.1.6]
Organism
mna  Miniopterus natalensis
Pathway
mna00564  Glycerophospholipid metabolism
mna04725  Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107527946 (CHAT)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    107527946 (CHAT)
Enzymes [BR:mna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.6  choline O-acetyltransferase
     107527946 (CHAT)
SSDB
Motif
Pfam: Carn_acyltransf
Other DBs
NCBI-GeneID: 107527946
NCBI-ProteinID: XP_016056333
LinkDB
Position
Unknown
AA seq 640 aa
MPILEKKPQKMAAKTLSSEEAEMPKLPVPPLQQTLATYLRCMQHLVPREQFRRSQAIVQQ
FGAPGGLGETLQQKLLERQEKTANWVSEYWLNDMYLNNRLALPVNSSPAVIFSRQHFQDS
NDQLRFAASLISGVLDYKALLDSHSIPTDCAKGQLSGQQLCMKQYYGLFSSYRLPGHTQD
TLVAQKSSVMPEPEHIIVACCNQFFVLDVVINFRRLSEGDLFTQLRKIVKMASSEDERLP
PIGLLTSDGRSQWAEARTVLMKDSTNRDSLDMIERCVCLVCLDAPGGCEPSDTNRALQLL
HGGGCGKNGANRWYDKSLQFVVGRDGTCGVVCEHSPFDGIVLVQCVEHLLKHMTSSSKKL
VRADSVSELPAPRRLRWKCSPVIQGFLASSAEKLQRIVKNLDFIVYKFDTYGKTFIKKQK
CSPDAFIQVALQLAFYRLHRRLAPTYESASIRRFQEGRVDNIRSATPEALSFVRAITDHK
ATVPDSEKLLLLRDAIRAQTEYTVMAITGMAIDNHLLGLRELARDVCKELPDMFTDETYL
MSNRFVLSTSQVPTTMEMFCCYGPVVPNGYGACYNPQPESILFCVSSFHSCQETSSARFA
KAVGESLAEMAGLCRAPQPAAGEPLATGETAATPGQCHQP
NT seq 1923 nt   +upstreamnt  +downstreamnt
atgcctatcctggaaaaaaaaccccagaagatggcagcaaaaactctcagcagtgaggag
gctgagatgcccaaactcccagtgcccccactgcagcagaccctggccacttacctgcgc
tgcatgcagcacttggtgcccagggagcagttcaggaggagccaggccatcgtgcagcag
tttggggcccctggtggcctcggcgagaccctgcagcagaagctcctggaacggcaggag
aagacggccaactgggtgtctgagtactggctgaacgacatgtatctcaataaccgcctg
gccctgcctgtcaactccagcccagctgtgatcttctcccgacagcacttccaggactcc
aatgaccagctaaggtttgccgccagcctgatctccggagtgctggactacaaggcgctg
ctggacagtcattccatccccactgactgtgccaagggccagctgtcagggcagcagctc
tgtatgaagcaatactacggcctcttttcctcttaccgcctccctggccacacccaggac
acactggtggcccagaagagcagtgtcatgcctgagcccgagcatatcattgtggcctgc
tgcaaccagttctttgtcttggatgttgtcattaatttccgccgtctcagtgagggggat
ctgttcactcagttgagaaaaatagtcaaaatggcttccagcgaggacgaacgcttgcct
ccgatcggcctgctgacatcagacgggaggagccagtgggctgaggccaggacagtcctc
atgaaagactccaccaaccgggactcgctggacatgatcgagcgctgcgtctgcctggtg
tgcctggacgcccctgggggctgcgagcccagtgacaccaacagggcgctccagctcctt
cacggtggaggctgcggcaagaatggggccaaccgctggtacgacaagtccctgcagttt
gtggtgggccgggatggcacctgcggcgtggtgtgcgagcactccccgttcgacgggatc
gtcctggtgcagtgcgtggagcatctgctcaagcacatgacgagcagcagcaagaagctg
gtccgcgccgactcggtcagtgagctgccggccccgcggaggctgaggtggaagtgctcc
cccgtaattcaaggcttcttagcctcctcagcagagaaactccaacgaatagtaaagaat
ctcgacttcattgtttataagtttgacacctatggaaaaacgttcattaagaagcagaaa
tgcagccctgacgcctttattcaggtggccctccaactggccttctacaggctccatcgc
agactcgcgcccacctacgagagcgcatccattcgccgattccaggagggacgggtggac
aacatccgatcggccactccagaggcactgagttttgtgagagccatcactgaccacaag
gccaccgtgccggattcggagaagctgctgctcctgagggatgccatccgcgcccagacc
gagtacacagtcatggccataactgggatggcgatcgacaaccatctgctggggctgagg
gagctggcccgggacgtgtgcaaggagctgcctgacatgttcacggatgaaacatacttg
atgagcaatcgatttgtcctctccaccagccaggtgcccacaaccatggagatgttttgc
tgctacgggcccgtggtgcccaacgggtacggcgcctgctacaacccgcagcccgagagc
atcctgttctgcgtgtctagcttccacagctgccaggagacctcttcggccaggttcgcg
aaggccgtgggggagagcctcgccgagatggcaggcctctgccgcgcgccacagcccgca
gcgggcgagccgctggccacaggggaaacggcagcaacgcccggccagtgccaccaaccc
tga

DBGET integrated database retrieval system