KEGG   Miniopterus natalensis: 107527950
Entry
107527950         CDS       T05883                                 

Gene name
ALOX5
Definition
(RefSeq) arachidonate 5-lipoxygenase
  KO
K00461  arachidonate 5-lipoxygenase [EC:1.13.11.34]
Organism
mna  Miniopterus natalensis
Pathway
mna00590  Arachidonic acid metabolism
mna01100  Metabolic pathways
mna04664  Fc epsilon RI signaling pathway
mna04726  Serotonergic synapse
mna04913  Ovarian steroidogenesis
mna05145  Toxoplasmosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    107527950 (ALOX5)
 09150 Organismal Systems
  09151 Immune system
   04664 Fc epsilon RI signaling pathway
    107527950 (ALOX5)
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    107527950 (ALOX5)
  09156 Nervous system
   04726 Serotonergic synapse
    107527950 (ALOX5)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107527950 (ALOX5)
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.34  arachidonate 5-lipoxygenase
     107527950 (ALOX5)
SSDB
Motif
Pfam: Lipoxygenase
Other DBs
NCBI-GeneID: 107527950
NCBI-ProteinID: XP_016056337
LinkDB
Position
Unknown
AA seq 529 aa
MEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQSSWSDF
ADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNGCNPVLIQRCTKLPEKLPVTTEMVEC
SLERQLTLEQEVEQGNIFIVDFELLDGVDANKTDPCTLQFLAAPICLLYKNLANKMTPIA
IQLNQVPGDENPIFLPSDAKYDWLLAKIWVRSCDFHVHQTITHLLRTHLVSEVFGIAMYR
QLPAVHPIFKLLVAHVRFTIAINTKAREQLICEYGLFDKANATGGGGHVQMVQKAMQDLT
YTSLCFPEAIKARGMDSTEDIPYYFYRDDGLLVWDAIKAFTADVVDIYYESDQVVVEDQE
LQDFVKDVYVYGMRGKKASGFPKSVKTREKLSEYLTVVIFTASAQHAAVNFGQYDWCSWI
PNAPPTMRAPPPTAKGVVTIEQIVETLPDRGRSCWHLGAVWALSQFQENELFLGMYPEEH
FIEKPVKEAMTRFRKNLDAIVSVIAERNKNKKLPYYYLSPDRIPNSVAI
NT seq 1590 nt   +upstreamnt  +downstreamnt
atggaatggaaccctggattccccttgagcatcgatgccaaatgccacaaggatttacct
cgtgacatccagtttgatagtgagaaaggagtggactttgtcctgaactactcaaaagcg
atggagaacctgttcatcaaccgcttcatgcacatgttccagtcatcctggagcgacttt
gctgacttcgaaaaaatcttcgtgaagatcagcaacactatttctgagcgggtcatgaac
cactggcaggaagacctcatgttcggctaccagttcctgaacggctgcaaccccgtgctg
atccagcgctgcaccaagctgcccgagaagctgccagtgaccacggagatggtggagtgc
agcctggagcggcagctcactctggagcaggaggtcgagcaagggaacatcttcatcgtg
gactttgagctgctggatggcgtcgatgccaacaagacagacccctgcacgctgcagttc
ctggccgcacccatctgcctgctgtacaagaacctggccaacaagatgacccccattgcc
atccagctcaaccaagtcccaggagacgaaaaccccattttccttccttccgatgcaaaa
tatgactggcttctggccaaaatctgggtgcgctcctgtgacttccacgtccaccagacc
atcactcacctcctgcgcacacacctggtgtccgaagtcttcggcatcgccatgtaccgc
cagctgcccgctgtgcaccccatttttaagctcctggtggcacacgtgcggttcaccatc
gccatcaacaccaaggcccgtgagcagctcatctgcgagtacggcctctttgacaaggcc
aacgccacagggggtggcgggcacgtgcagatggtgcagaaggccatgcaggaccttacc
tacacctccctgtgcttccctgaggccatcaaggcccggggcatggacagcaccgaggac
atcccctactacttctaccgggatgacgggctcctggtgtgggacgctatcaaggcgttc
acagccgacgtggtggacatctactacgagagcgaccaggtggtggtggaggaccaggag
ctgcaggacttcgtgaaggacgtgtatgtgtacggcatgcggggcaagaaggcgtcaggt
ttccccaagtccgtcaagaccagggagaagctgtctgagtacctgacggtggtgatcttc
acggcctcagcccagcatgcagcagtgaacttcggccagtatgactggtgttcctggatc
cccaatgcccccccaaccatgcgagccccgccacccacggcaaagggtgtggtcaccatt
gagcagattgtggaaacactgccagaccgaggccgctcctgctggcatctgggcgcagtg
tgggcgctgagccagtttcaagaaaatgagctgttcctgggcatgtacccagaggagcat
ttcatagagaaaccagtcaaggaggccatgacccgattccgcaagaacctggacgccatc
gtcagcgtgattgccgagcgcaacaagaacaagaagctgccctattactacctgtctcca
gaccggatccccaacagcgttgccatatga

DBGET integrated database retrieval system