KEGG   Miniopterus natalensis: 107527953
Entry
107527953         CDS       T05883                                 

Gene name
MAPK8
Definition
(RefSeq) mitogen-activated protein kinase 8 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
mna  Miniopterus natalensis
Pathway
mna01522  Endocrine resistance
mna04010  MAPK signaling pathway
mna04012  ErbB signaling pathway
mna04014  Ras signaling pathway
mna04024  cAMP signaling pathway
mna04068  FoxO signaling pathway
mna04071  Sphingolipid signaling pathway
mna04137  Mitophagy - animal
mna04140  Autophagy - animal
mna04141  Protein processing in endoplasmic reticulum
mna04210  Apoptosis
mna04215  Apoptosis - multiple species
mna04217  Necroptosis
mna04310  Wnt signaling pathway
mna04380  Osteoclast differentiation
mna04510  Focal adhesion
mna04530  Tight junction
mna04620  Toll-like receptor signaling pathway
mna04621  NOD-like receptor signaling pathway
mna04622  RIG-I-like receptor signaling pathway
mna04625  C-type lectin receptor signaling pathway
mna04657  IL-17 signaling pathway
mna04658  Th1 and Th2 cell differentiation
mna04659  Th17 cell differentiation
mna04660  T cell receptor signaling pathway
mna04664  Fc epsilon RI signaling pathway
mna04668  TNF signaling pathway
mna04722  Neurotrophin signaling pathway
mna04723  Retrograde endocannabinoid signaling
mna04728  Dopaminergic synapse
mna04750  Inflammatory mediator regulation of TRP channels
mna04910  Insulin signaling pathway
mna04912  GnRH signaling pathway
mna04914  Progesterone-mediated oocyte maturation
mna04917  Prolactin signaling pathway
mna04920  Adipocytokine signaling pathway
mna04926  Relaxin signaling pathway
mna04930  Type II diabetes mellitus
mna04931  Insulin resistance
mna04932  Non-alcoholic fatty liver disease
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna04935  Growth hormone synthesis, secretion and action
mna05010  Alzheimer disease
mna05012  Parkinson disease
mna05016  Huntington disease
mna05017  Spinocerebellar ataxia
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05132  Salmonella infection
mna05133  Pertussis
mna05135  Yersinia infection
mna05142  Chagas disease
mna05145  Toxoplasmosis
mna05152  Tuberculosis
mna05161  Hepatitis B
mna05162  Measles
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05171  Coronavirus disease - COVID-19
mna05200  Pathways in cancer
mna05210  Colorectal cancer
mna05212  Pancreatic cancer
mna05231  Choline metabolism in cancer
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107527953 (MAPK8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107527953 (MAPK8)
   04012 ErbB signaling pathway
    107527953 (MAPK8)
   04014 Ras signaling pathway
    107527953 (MAPK8)
   04310 Wnt signaling pathway
    107527953 (MAPK8)
   04668 TNF signaling pathway
    107527953 (MAPK8)
   04068 FoxO signaling pathway
    107527953 (MAPK8)
   04071 Sphingolipid signaling pathway
    107527953 (MAPK8)
   04024 cAMP signaling pathway
    107527953 (MAPK8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107527953 (MAPK8)
   04137 Mitophagy - animal
    107527953 (MAPK8)
  09143 Cell growth and death
   04210 Apoptosis
    107527953 (MAPK8)
   04215 Apoptosis - multiple species
    107527953 (MAPK8)
   04217 Necroptosis
    107527953 (MAPK8)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107527953 (MAPK8)
   04530 Tight junction
    107527953 (MAPK8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107527953 (MAPK8)
   04621 NOD-like receptor signaling pathway
    107527953 (MAPK8)
   04622 RIG-I-like receptor signaling pathway
    107527953 (MAPK8)
   04625 C-type lectin receptor signaling pathway
    107527953 (MAPK8)
   04660 T cell receptor signaling pathway
    107527953 (MAPK8)
   04658 Th1 and Th2 cell differentiation
    107527953 (MAPK8)
   04659 Th17 cell differentiation
    107527953 (MAPK8)
   04657 IL-17 signaling pathway
    107527953 (MAPK8)
   04664 Fc epsilon RI signaling pathway
    107527953 (MAPK8)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107527953 (MAPK8)
   04920 Adipocytokine signaling pathway
    107527953 (MAPK8)
   04912 GnRH signaling pathway
    107527953 (MAPK8)
   04914 Progesterone-mediated oocyte maturation
    107527953 (MAPK8)
   04917 Prolactin signaling pathway
    107527953 (MAPK8)
   04926 Relaxin signaling pathway
    107527953 (MAPK8)
   04935 Growth hormone synthesis, secretion and action
    107527953 (MAPK8)
  09156 Nervous system
   04728 Dopaminergic synapse
    107527953 (MAPK8)
   04723 Retrograde endocannabinoid signaling
    107527953 (MAPK8)
   04722 Neurotrophin signaling pathway
    107527953 (MAPK8)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107527953 (MAPK8)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107527953 (MAPK8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107527953 (MAPK8)
   05231 Choline metabolism in cancer
    107527953 (MAPK8)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107527953 (MAPK8)
   05212 Pancreatic cancer
    107527953 (MAPK8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107527953 (MAPK8)
   05012 Parkinson disease
    107527953 (MAPK8)
   05016 Huntington disease
    107527953 (MAPK8)
   05017 Spinocerebellar ataxia
    107527953 (MAPK8)
   05020 Prion disease
    107527953 (MAPK8)
   05022 Pathways of neurodegeneration - multiple diseases
    107527953 (MAPK8)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107527953 (MAPK8)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107527953 (MAPK8)
   04932 Non-alcoholic fatty liver disease
    107527953 (MAPK8)
   04931 Insulin resistance
    107527953 (MAPK8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107527953 (MAPK8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107527953 (MAPK8)
   05135 Yersinia infection
    107527953 (MAPK8)
   05133 Pertussis
    107527953 (MAPK8)
   05152 Tuberculosis
    107527953 (MAPK8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107527953 (MAPK8)
   05170 Human immunodeficiency virus 1 infection
    107527953 (MAPK8)
   05161 Hepatitis B
    107527953 (MAPK8)
   05171 Coronavirus disease - COVID-19
    107527953 (MAPK8)
   05162 Measles
    107527953 (MAPK8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107527953 (MAPK8)
   05169 Epstein-Barr virus infection
    107527953 (MAPK8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107527953 (MAPK8)
   05142 Chagas disease
    107527953 (MAPK8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107527953 (MAPK8)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107527953 (MAPK8)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107527953 (MAPK8)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2 DUF530
Other DBs
NCBI-GeneID: 107527953
NCBI-ProteinID: XP_016056339
LinkDB
Position
Unknown
AA seq 427 aa
MSRSKRDSNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSPSVNDVSSMSTDPTLASDTDSSLEASA
GPLGCCR
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgagcagaagtaagcgtgacagcaatttttatagtgtagagatcggagattctacattt
acagtcctgaaacgatatcagaatttaaaacctataggctcaggagctcaagggatagta
tgtgcagcttatgatgccattcttgaaagaaatgttgcaatcaagaagctaagccggcca
tttcagaatcaaacccatgctaaacgggcttacagagagctggttcttatgaaatgtgtt
aatcacaaaaatataattggccttttgaatgtttttacaccacagaaatccctagaagaa
tttcaagatgtttacatagtcatggagctcatggatgcaaatctttgccaagtgattcag
atggaactagatcatgaaagaatgtcctaccttctctatcaaatgctgtgtggaatcaag
caccttcactctgctggaattattcatcgggacttaaagccgagtaatatagtagtaaaa
tcagactgcactttgaagattcttgactttggactggccaggactgcaggaactagtttt
atgatgacaccttacgtagtgactcgctactacagagcacctgaagtcatcctagggatg
ggctacaaagaaaacgttgacatttggtcagttgggtgcatcatgggagaaatgatcaaa
ggtggtgttttgttcccaggtacagatcatattgatcagtggaataaagttattgaacag
cttggaacaccgtgtcctgaattcatgaagaaactacaaccaacagtaaggacttacgtt
gagaacagacctaaatacgctggctacagcttcgagaaactctttcctgatgtgctgttc
cctgctgactcagaacacaacaaacttaaagccagtcaggcgagggatttattatccaaa
atgctggtgattgacgcatccaaaaggatctctgtagatgaggccctccagcacccatac
atcaacgtctggtacgacccctctgaggcagaggctccaccaccaaagatacctgacaag
cagttagatgagcgggagcacacgatagaagagtggaaagaattgatatacaaggaagtt
atggacttggaagagagaaccaagaatggagttatacgggggcagccctctcctttaggt
gcagcagtgatcaatggctctcagcacccgtcgtcatcgccgtccgtcaacgacgtgtct
tcaatgtcaacagacccgactttggcctcggacaccgacagcagtctagaagcatcagcg
ggacctctgggctgctgtagatga

KEGG   Miniopterus natalensis: 107528432
Entry
107528432         CDS       T05883                                 

Gene name
MAPK9
Definition
(RefSeq) mitogen-activated protein kinase 9 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
mna  Miniopterus natalensis
Pathway
mna01522  Endocrine resistance
mna04010  MAPK signaling pathway
mna04012  ErbB signaling pathway
mna04014  Ras signaling pathway
mna04024  cAMP signaling pathway
mna04068  FoxO signaling pathway
mna04071  Sphingolipid signaling pathway
mna04137  Mitophagy - animal
mna04140  Autophagy - animal
mna04141  Protein processing in endoplasmic reticulum
mna04210  Apoptosis
mna04215  Apoptosis - multiple species
mna04217  Necroptosis
mna04310  Wnt signaling pathway
mna04380  Osteoclast differentiation
mna04510  Focal adhesion
mna04530  Tight junction
mna04620  Toll-like receptor signaling pathway
mna04621  NOD-like receptor signaling pathway
mna04622  RIG-I-like receptor signaling pathway
mna04625  C-type lectin receptor signaling pathway
mna04657  IL-17 signaling pathway
mna04658  Th1 and Th2 cell differentiation
mna04659  Th17 cell differentiation
mna04660  T cell receptor signaling pathway
mna04664  Fc epsilon RI signaling pathway
mna04668  TNF signaling pathway
mna04722  Neurotrophin signaling pathway
mna04723  Retrograde endocannabinoid signaling
mna04728  Dopaminergic synapse
mna04750  Inflammatory mediator regulation of TRP channels
mna04910  Insulin signaling pathway
mna04912  GnRH signaling pathway
mna04914  Progesterone-mediated oocyte maturation
mna04917  Prolactin signaling pathway
mna04920  Adipocytokine signaling pathway
mna04926  Relaxin signaling pathway
mna04930  Type II diabetes mellitus
mna04931  Insulin resistance
mna04932  Non-alcoholic fatty liver disease
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna04935  Growth hormone synthesis, secretion and action
mna05010  Alzheimer disease
mna05012  Parkinson disease
mna05016  Huntington disease
mna05017  Spinocerebellar ataxia
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05132  Salmonella infection
mna05133  Pertussis
mna05135  Yersinia infection
mna05142  Chagas disease
mna05145  Toxoplasmosis
mna05152  Tuberculosis
mna05161  Hepatitis B
mna05162  Measles
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05171  Coronavirus disease - COVID-19
mna05200  Pathways in cancer
mna05210  Colorectal cancer
mna05212  Pancreatic cancer
mna05231  Choline metabolism in cancer
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107528432 (MAPK9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107528432 (MAPK9)
   04012 ErbB signaling pathway
    107528432 (MAPK9)
   04014 Ras signaling pathway
    107528432 (MAPK9)
   04310 Wnt signaling pathway
    107528432 (MAPK9)
   04668 TNF signaling pathway
    107528432 (MAPK9)
   04068 FoxO signaling pathway
    107528432 (MAPK9)
   04071 Sphingolipid signaling pathway
    107528432 (MAPK9)
   04024 cAMP signaling pathway
    107528432 (MAPK9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107528432 (MAPK9)
   04137 Mitophagy - animal
    107528432 (MAPK9)
  09143 Cell growth and death
   04210 Apoptosis
    107528432 (MAPK9)
   04215 Apoptosis - multiple species
    107528432 (MAPK9)
   04217 Necroptosis
    107528432 (MAPK9)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107528432 (MAPK9)
   04530 Tight junction
    107528432 (MAPK9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107528432 (MAPK9)
   04621 NOD-like receptor signaling pathway
    107528432 (MAPK9)
   04622 RIG-I-like receptor signaling pathway
    107528432 (MAPK9)
   04625 C-type lectin receptor signaling pathway
    107528432 (MAPK9)
   04660 T cell receptor signaling pathway
    107528432 (MAPK9)
   04658 Th1 and Th2 cell differentiation
    107528432 (MAPK9)
   04659 Th17 cell differentiation
    107528432 (MAPK9)
   04657 IL-17 signaling pathway
    107528432 (MAPK9)
   04664 Fc epsilon RI signaling pathway
    107528432 (MAPK9)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107528432 (MAPK9)
   04920 Adipocytokine signaling pathway
    107528432 (MAPK9)
   04912 GnRH signaling pathway
    107528432 (MAPK9)
   04914 Progesterone-mediated oocyte maturation
    107528432 (MAPK9)
   04917 Prolactin signaling pathway
    107528432 (MAPK9)
   04926 Relaxin signaling pathway
    107528432 (MAPK9)
   04935 Growth hormone synthesis, secretion and action
    107528432 (MAPK9)
  09156 Nervous system
   04728 Dopaminergic synapse
    107528432 (MAPK9)
   04723 Retrograde endocannabinoid signaling
    107528432 (MAPK9)
   04722 Neurotrophin signaling pathway
    107528432 (MAPK9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107528432 (MAPK9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107528432 (MAPK9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107528432 (MAPK9)
   05231 Choline metabolism in cancer
    107528432 (MAPK9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107528432 (MAPK9)
   05212 Pancreatic cancer
    107528432 (MAPK9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107528432 (MAPK9)
   05012 Parkinson disease
    107528432 (MAPK9)
   05016 Huntington disease
    107528432 (MAPK9)
   05017 Spinocerebellar ataxia
    107528432 (MAPK9)
   05020 Prion disease
    107528432 (MAPK9)
   05022 Pathways of neurodegeneration - multiple diseases
    107528432 (MAPK9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107528432 (MAPK9)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107528432 (MAPK9)
   04932 Non-alcoholic fatty liver disease
    107528432 (MAPK9)
   04931 Insulin resistance
    107528432 (MAPK9)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107528432 (MAPK9)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107528432 (MAPK9)
   05135 Yersinia infection
    107528432 (MAPK9)
   05133 Pertussis
    107528432 (MAPK9)
   05152 Tuberculosis
    107528432 (MAPK9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107528432 (MAPK9)
   05170 Human immunodeficiency virus 1 infection
    107528432 (MAPK9)
   05161 Hepatitis B
    107528432 (MAPK9)
   05171 Coronavirus disease - COVID-19
    107528432 (MAPK9)
   05162 Measles
    107528432 (MAPK9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107528432 (MAPK9)
   05169 Epstein-Barr virus infection
    107528432 (MAPK9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107528432 (MAPK9)
   05142 Chagas disease
    107528432 (MAPK9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107528432 (MAPK9)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107528432 (MAPK9)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107528432 (MAPK9)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 107528432
NCBI-ProteinID: XP_016056994
LinkDB
Position
Unknown
AA seq 424 aa
MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSADFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGAL
EGCR
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgagtgacagtaaatgtgacagtcagttttacagtgtgcaagtggcagactcaactttc
actgtcctaaagcgttatcagcagttgaaaccaattggctctggagcccaaggaattgtt
tgtgctgcttttgatacggttcttgggataaatgttgcagtcaagaaactaagccggcct
tttcaaaatcaaactcatgcaaagagagcttatcgtgaactcgtgctcctaaaatgtgtc
aatcataaaaatataattagtttgttaaatgtgtttacaccacaaaaaactctagaagaa
tttcaagatgtgtatttggttatggaattaatggatgctaacttatgtcaggttattcat
atggagttggaccatgagaggatgtcctatcttctttaccagatgctctgtggcattaaa
caccttcattcagccggtatcattcatcgagatttgaaacccagcaacatcgtagtaaag
tcagactgcacccttaagatcctggactttggcctagcccggacagcgtgtaccaacttc
atgatgaccccttatgtggtgacacgatattaccgggcaccagaagtcatcctgggtatg
ggctataaagagaacgttgatatctggtcagtgggttgcatcatgggcgagctggtgaaa
ggttgtgtgatattccaaggcactgaccatattgatcagtggaataaagttattgagcag
ctaggaacaccgtctgcagatttcatgaagaaacttcagccaactgtgagaaattatgta
gaaaacagaccaaagtatcctggaatcaaatttgaagaactctttccagattggatattc
ccatcagaatcggaacgagacaaaattaaaacaagccaagctagagacctgttatcaaaa
atgttagtgatagaccctgacaagaggatctctgtggacgaagctttgcgtcacccttac
attactgtttggtatgaccctgctgaagcggaagcgccaccacctcaaatttacgatgcc
cagttggaagaaagagaacatgcaattgaagaatggaaagagctgatttacaaagaagta
atggattgggaagaaagaagcaagaacggtgttgtgaaagatcagccttcagatgcagca
gtaagtagcaacgccactccttctcagtcatcatctatcaatgacatttcatccatgtcc
accgagcagacactggcctcagacacagacagcagcctcgatgcctccacgggagccctt
gaaggttgtcgatga

KEGG   Miniopterus natalensis: 107537133
Entry
107537133         CDS       T05883                                 

Gene name
MAPK10
Definition
(RefSeq) mitogen-activated protein kinase 10 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
mna  Miniopterus natalensis
Pathway
mna01522  Endocrine resistance
mna04010  MAPK signaling pathway
mna04012  ErbB signaling pathway
mna04014  Ras signaling pathway
mna04024  cAMP signaling pathway
mna04068  FoxO signaling pathway
mna04071  Sphingolipid signaling pathway
mna04137  Mitophagy - animal
mna04140  Autophagy - animal
mna04141  Protein processing in endoplasmic reticulum
mna04210  Apoptosis
mna04215  Apoptosis - multiple species
mna04217  Necroptosis
mna04310  Wnt signaling pathway
mna04380  Osteoclast differentiation
mna04510  Focal adhesion
mna04530  Tight junction
mna04620  Toll-like receptor signaling pathway
mna04621  NOD-like receptor signaling pathway
mna04622  RIG-I-like receptor signaling pathway
mna04625  C-type lectin receptor signaling pathway
mna04657  IL-17 signaling pathway
mna04658  Th1 and Th2 cell differentiation
mna04659  Th17 cell differentiation
mna04660  T cell receptor signaling pathway
mna04664  Fc epsilon RI signaling pathway
mna04668  TNF signaling pathway
mna04722  Neurotrophin signaling pathway
mna04723  Retrograde endocannabinoid signaling
mna04728  Dopaminergic synapse
mna04750  Inflammatory mediator regulation of TRP channels
mna04910  Insulin signaling pathway
mna04912  GnRH signaling pathway
mna04914  Progesterone-mediated oocyte maturation
mna04917  Prolactin signaling pathway
mna04920  Adipocytokine signaling pathway
mna04926  Relaxin signaling pathway
mna04930  Type II diabetes mellitus
mna04931  Insulin resistance
mna04932  Non-alcoholic fatty liver disease
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna04935  Growth hormone synthesis, secretion and action
mna05010  Alzheimer disease
mna05012  Parkinson disease
mna05016  Huntington disease
mna05017  Spinocerebellar ataxia
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05132  Salmonella infection
mna05133  Pertussis
mna05135  Yersinia infection
mna05142  Chagas disease
mna05145  Toxoplasmosis
mna05152  Tuberculosis
mna05161  Hepatitis B
mna05162  Measles
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05171  Coronavirus disease - COVID-19
mna05200  Pathways in cancer
mna05210  Colorectal cancer
mna05212  Pancreatic cancer
mna05231  Choline metabolism in cancer
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107537133 (MAPK10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107537133 (MAPK10)
   04012 ErbB signaling pathway
    107537133 (MAPK10)
   04014 Ras signaling pathway
    107537133 (MAPK10)
   04310 Wnt signaling pathway
    107537133 (MAPK10)
   04668 TNF signaling pathway
    107537133 (MAPK10)
   04068 FoxO signaling pathway
    107537133 (MAPK10)
   04071 Sphingolipid signaling pathway
    107537133 (MAPK10)
   04024 cAMP signaling pathway
    107537133 (MAPK10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107537133 (MAPK10)
   04137 Mitophagy - animal
    107537133 (MAPK10)
  09143 Cell growth and death
   04210 Apoptosis
    107537133 (MAPK10)
   04215 Apoptosis - multiple species
    107537133 (MAPK10)
   04217 Necroptosis
    107537133 (MAPK10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107537133 (MAPK10)
   04530 Tight junction
    107537133 (MAPK10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107537133 (MAPK10)
   04621 NOD-like receptor signaling pathway
    107537133 (MAPK10)
   04622 RIG-I-like receptor signaling pathway
    107537133 (MAPK10)
   04625 C-type lectin receptor signaling pathway
    107537133 (MAPK10)
   04660 T cell receptor signaling pathway
    107537133 (MAPK10)
   04658 Th1 and Th2 cell differentiation
    107537133 (MAPK10)
   04659 Th17 cell differentiation
    107537133 (MAPK10)
   04657 IL-17 signaling pathway
    107537133 (MAPK10)
   04664 Fc epsilon RI signaling pathway
    107537133 (MAPK10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107537133 (MAPK10)
   04920 Adipocytokine signaling pathway
    107537133 (MAPK10)
   04912 GnRH signaling pathway
    107537133 (MAPK10)
   04914 Progesterone-mediated oocyte maturation
    107537133 (MAPK10)
   04917 Prolactin signaling pathway
    107537133 (MAPK10)
   04926 Relaxin signaling pathway
    107537133 (MAPK10)
   04935 Growth hormone synthesis, secretion and action
    107537133 (MAPK10)
  09156 Nervous system
   04728 Dopaminergic synapse
    107537133 (MAPK10)
   04723 Retrograde endocannabinoid signaling
    107537133 (MAPK10)
   04722 Neurotrophin signaling pathway
    107537133 (MAPK10)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107537133 (MAPK10)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107537133 (MAPK10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107537133 (MAPK10)
   05231 Choline metabolism in cancer
    107537133 (MAPK10)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107537133 (MAPK10)
   05212 Pancreatic cancer
    107537133 (MAPK10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107537133 (MAPK10)
   05012 Parkinson disease
    107537133 (MAPK10)
   05016 Huntington disease
    107537133 (MAPK10)
   05017 Spinocerebellar ataxia
    107537133 (MAPK10)
   05020 Prion disease
    107537133 (MAPK10)
   05022 Pathways of neurodegeneration - multiple diseases
    107537133 (MAPK10)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107537133 (MAPK10)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107537133 (MAPK10)
   04932 Non-alcoholic fatty liver disease
    107537133 (MAPK10)
   04931 Insulin resistance
    107537133 (MAPK10)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107537133 (MAPK10)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107537133 (MAPK10)
   05135 Yersinia infection
    107537133 (MAPK10)
   05133 Pertussis
    107537133 (MAPK10)
   05152 Tuberculosis
    107537133 (MAPK10)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107537133 (MAPK10)
   05170 Human immunodeficiency virus 1 infection
    107537133 (MAPK10)
   05161 Hepatitis B
    107537133 (MAPK10)
   05171 Coronavirus disease - COVID-19
    107537133 (MAPK10)
   05162 Measles
    107537133 (MAPK10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107537133 (MAPK10)
   05169 Epstein-Barr virus infection
    107537133 (MAPK10)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107537133 (MAPK10)
   05142 Chagas disease
    107537133 (MAPK10)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107537133 (MAPK10)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107537133 (MAPK10)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107537133 (MAPK10)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 107537133
NCBI-ProteinID: XP_016068555
LinkDB
Position
Unknown
AA seq 464 aa
MSLHLLYYCSEPTLDVKIAFCQGFDKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN
RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYIN
VWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAA
VNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgagcctccatttattgtactactgcagtgaaccaaccttggatgtgaaaattgccttt
tgtcagggattcgataaacaagtggatgtgtcatatattgccaaacattacaacatgagc
aaaagcaaagttgacaaccagttctacagtgtggaagtgggagactcaaccttcacagtt
ctcaagcgctaccagaatctaaagcctattggctctggggctcagggaatagtttgtgct
gcatatgatgctgtccttgacagaaatgtggccattaagaagctcagcagaccctttcag
aaccaaacgcatgccaagagagcttaccgggaactggtcctcatgaagtgtgtgaaccat
aaaaatattattagtttattaaatgtcttcacaccccagaaaacgctggaggagttccaa
gatgtttacttagtaatggaactgatggatgccaacttgtgtcaggtgattcagatggaa
ttagaccatgaacgaatgtcttaccttctataccaaatgttgtgtggcatcaagcacctt
cactctgctggaattattcacagggatttaaaaccaagtaacattgtagtcaagtccgat
tgtacattgaaaatccttgactttggactggccaggaccgcgggcacaagcttcatgatg
actccttatgtggtgacgcgttattacagagcccctgaggtcatcttgggaatgggctac
aaggagaacgtggatatatggtctgtgggatgcattatgggagagatggttcgccacaaa
atcctctttccgggaagggactacattgaccagtggaacaaagtaattgagcaactagga
acaccatgtccagaattcatgaagaaattgcaacccacagtaagaaactatgtggagaat
cggcctaagtatgcaggactcaccttccccaagctctttccagattccctcttccccgcg
gattctgagcacaataaactcaaagccagccaagccagggacttgttgtcgaagatgctc
gtgattgacccagccaaaaggatatcggtggacgacgccttgcagcacccgtacatcaac
gtctggtatgaccccgccgaggtggaggcgcctccacctcagatatatgacaagcagttg
gatgaaagagaacacaccattgaagaatggaaagaacttatctacaaggaagtaatgaat
tcagaagaaaagactaaaaacggtgtggtaaaaggccagccttctccttcaggtgcagca
gtgaacagcagcgagagcctccctccgtcttcgtccgtcaacgacatctcctccatgtcc
accgaccagaccctggcgtccgacactgacagcagcctggaagcctcggcgggcccgctg
ggttgttgcaggtga

DBGET integrated database retrieval system