KEGG   Miniopterus natalensis: 107527961
Entry
107527961         CDS       T05883                                 

Gene name
TJP1
Definition
(RefSeq) tight junction protein ZO-1
  KO
K05701  tight junction protein 1
Organism
mna  Miniopterus natalensis
Pathway
mna04520  Adherens junction
mna04530  Tight junction
mna04540  Gap junction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107527961 (TJP1)
   04530 Tight junction
    107527961 (TJP1)
   04540 Gap junction
    107527961 (TJP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mna04812]
    107527961 (TJP1)
Cytoskeleton proteins [BR:mna04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     107527961 (TJP1)
SSDB
Motif
Pfam: PDZ ZU5 PDZ_6 PDZ_2 Guanylate_kin SH3_2 SH3_1 RPOL_N
Other DBs
NCBI-GeneID: 107527961
NCBI-ProteinID: XP_016056349
LinkDB
Position
Unknown
AA seq 1749 aa
MTASLLLSQSTAMEETAIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVL
KGGPAEGQLQENDRVAMVNGVSMDNVEHAFAVQQLRKSGKTARITIRRKKKVQMPVSRPE
PAPASEQEEDSYEEDTHDHRSSRGALAGRRSEKSWARDRSASRERSLSPRSDRRSVASSQ
PAKPTKVTLVKSRKNEEYGLRLASHIFVKEISQDSLAARDGNIQEGDVVLKINGTVTENM
SLTDAKTLIERSKGKLKMVVQRDERATLLNVPDLADSIHSANASERDDISEIQSLASDHS
GPSHDRAPYHSRSRSPDQRSEPSDHSRHSPQQPSSGSHRSREEERVSKPGTVSTPVKHAE
DHTPKTVEEAIVERNEKQAPALPEPKPVYAQVGQPDVDLPVSPSDGVLPNSTHEEGILRP
SMKLVKFRKGDSVGLRLAGGNDVGIFVAGVLEDSPAAKEGLEEGDQILRVNNVDFTNIIR
EEAVLFLLDLPKGEEVTILAQKKKDVYRRIVESDVGDSFYIRTHFEYEKESPYGLSFNKG
EVFRVVDTLYNGKLGSWLAIRIGKSHKEVERGIIPNKNRAEQLASVQYTLPKTAGGDRAD
FWRFRGLRSSKRNLRKSREDLSAQPVQTKFPAYERVVLREAGFLRPVTIFGPIADVAREK
LAREEPDIYQIAKSEPRDAGTDQRSSGIIRLHTIKQIIDQDKHALLDVTPNAVDRLNYAQ
WYPIVVFLNPDSKQGVKTMRMRLCPESRKSARKLYERSHKLRKNNHHLFTTTINLNSMND
GWYGALKEAIQQQQNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHT
SDYEDTDTEGGAYTDQELDETLNDEVGTPPESAITRSSEPVREDSSGMHHESQPFPPYTP
QAQPQPVHRIDSPGFKTASQQKAEASSPVPYLSPETNPAPSTSAVNHSVKFTHVRLEEPA
PAPPASHAPQADPLRAPSAEAAHTLLRDQGASLPPHVDPPQVYRKDPYPEDTRQNHVLKQ
PAVGHPGQRPDREPNLSFEHHPQYAEKQASRDLEQPAYRYDSSGYADQFSRNFDHRVRYE
ERVPAYEEHWSYYEDKQPYQPRPPFENQHSRDLDSRQHPEESSERGYFPRFEEPAPLSYD
SRARYDQPPRPSTLRHEEPPAPGYDVHGRYRPEAQPYSSGPKAAEPKQYYDQYPRGYEQV
PSQGFPSKAGPYEPLHGAAAAPLQVPAAQHKPEPPPASTKPLPPPPAPAEEEEDPAMKPQ
SVLTRVKMFENKRSASLESKKEENHTTGFKPPEVAAKPSGAPIVGPKAPPQSQFSDHDKT
LYRIPEPQKPQPKPPEDIVRSNHYDPEEDEEYYRKQLSYFDRRSFENKPPAHIPAGHLPE
PAKPVHSQHQPSLSSYASKGKSADTDAVERAFEKRYDPGQPAPGPALHAHAHAHAKGAHG
EGNSVSLDFQNSLVSKPEPPPSQNKPTTFRPMNREDPAQSTFYAQKSFTDKAPVNGTEQT
QKTVAPAYNRFTPKPYTSSARPFERKFESPKFSHNLLPSESAHKPDVSSKVPTSPKTLMK
AQPPEFDSGVETFSVHADKPRYQANSVSAVPKAVPVSPTAVPDEGDGEDGHTVVATARGV
FNGNGGVLSSIETGVSIIIPQGAIPEGMEQEIYFKVCRDNSILPPLDKEKGETLLSPLVM
CGPHGLKFLKPVELRLPHCASMTPDGWSFALKSSDSSSGDPKTWQNKCLPGDPNYLVGAN
CVSVLIDHF
NT seq 5250 nt   +upstreamnt  +downstreamnt
atgactgcttctcttttgctttcccagagcacagcgatggaggaaacagcgatatgggaa
cagcacacagtgacgcttcacagggctcctgggtttggatttggaattgcaatatccggc
gggagagataaccctcattttcagagcggggaaacctccatcgtcatttccgacgtgctg
aagggaggacctgccgaggggcagctgcaggaaaatgaccgtgttgcgatggttaatgga
gtgtccatggataatgtcgaacatgccttcgccgttcagcagctgaggaagagcgggaag
acggcgcgaattaccattcgaagaaagaagaaggttcagatgcccgtgagccgccccgag
cccgcgccggcgtctgagcaggaggaagacagctacgaggaggacacgcacgaccacagg
agcagccgcggggccctggcgggcaggcggagcgagaagagctgggcgagggacaggagc
gcaagcagagagaggagtctgtccccgcgatccgacaggcggtctgtggcctccagtcag
cccgccaaacccaccaaagtcacgttggtcaaatcccggaaaaatgaagaatatggtctt
cgactggccagccatatatttgtaaaggagatttcacaggacagtttggcagcaagagat
ggcaacattcaagaaggcgatgttgtgttaaagataaatggtaccgtgactgaaaatatg
tcactgacagatgcaaagacattgatcgagaggtctaaaggcaagctaaagatggtagtc
cagcgcgatgagcgggccaccctgctgaacgtccccgacctcgccgacagcatccactcc
gctaacgcctctgagcgagacgacatctcagaaattcagtcgctggcatcagatcattct
ggtccgtcacatgacagggcgccctaccacagccggtcacgatctcccgaccagcggtcg
gagccatctgatcattccagacactcgccacagcagcccagcagtggcagtcaccggagc
agagaggaggagagagtttctaaacctgggaccgtctcgacccctgtcaagcacgcagag
gaccacacacccaagactgtggaagaagcgatagttgagagaaatgagaaacaagccccc
gctcttccagaaccaaagcctgtgtatgctcaggttggacaaccagatgtggatttacct
gtcagcccgtctgacggtgtcctgccaaattcaacgcacgaagaggggattctccggccc
agcatgaaattggtaaaattcagaaaaggagatagtgtgggcttgcggctggctggtggc
aatgatgtcggaatatttgtagctggcgttctagaagatagccctgcagccaaagaaggc
ctggaagagggtgaccaaattctcagggtaaacaacgtcgacttcaccaacatcatacga
gaggaagctgtgctcttcctgctcgacctcccgaaaggagaggaggtgaccattctggcc
cagaaaaagaaggacgtttatcgtcgcatcgtggagtcagacgtaggagattctttctac
attagaacccactttgagtacgagaaggagtcgccctatggcctcagtttcaacaaaggc
gaggtgttccgtgtcgtggacaccctgtacaacgggaagctgggctcgtggctggcgatt
cgaatcggcaagagtcacaaggaggtggaacggggcatcatccctaataagaacagagct
gagcagttggccagtgtgcagtacacacttccaaagacagcaggaggggaccgtgcggac
ttctggcggttccgaggcctgcgcagctccaagaggaacctccggaaaagcagggaggac
ttgtcggctcagccggtccagacgaagttcccggcctatgaaagggtcgttcttcgggaa
gctggattcctgaggcctgtaaccatcttcggaccgatagctgacgtggccagagaaaag
ctggcgagagaagagccagatatttatcagattgcaaagagcgaaccccgagatgctggg
actgaccagcgcagctccggcatcattcgccttcatacaataaagcagataatagaccag
gacaagcatgctttattagatgtgaccccaaatgcagtcgatcgtctgaattacgcccag
tggtaccccattgtggtattcctgaaccccgattccaagcagggcgtgaagacaatgagg
atgaggctgtgtccagagtctcggaagagtgccaggaaattatacgagcggtctcacaaa
cttcgtaaaaataaccaccatctttttacaactacgattaacttaaattcaatgaacgac
gggtggtatggtgccctgaaggaagccattcagcagcagcagaaccagctggtgtgggtc
tctgaggggaaggcggacggtgctacaagtgatgaccttgatttgcatgacgatcggctg
tcctacctgtcagccccgggtagcgaatactcaatgtatagcacggacagtagacacact
tctgactatgaagacacagatacagaaggcggggcctacactgatcaagaactagatgaa
actcttaatgatgaggttgggactcccccagagtctgccattacccggtcctctgagccc
gtaagagaggactcctctggaatgcatcatgaaagccaaccctttcctccttacacacca
caagcgcagccacagccagtccatagaatagactccccgggatttaaaacagcctctcaa
cagaaagcagaagcctcatctccagtcccttacctttcgcctgaaacaaacccagcacca
tcaacctctgccgttaatcacagtgtaaagttcactcatgtcagactggaggagcccgcc
ccagcccctcccgcctctcacgcaccacaagctgaccctttacgagcaccaagtgccgag
gcagctcacacgctgctaagggaccaaggagcctcactgccgccgcatgtagacccacca
caggtgtatagaaaggacccctatcccgaggacacaaggcagaaccacgttctgaagcag
ccggctgtgggtcacccaggccagaggccagacagggagcctaatctgagcttcgagcac
cacccccagtatgcagagaaacaggccagcagagacctggagcagcccgcgtacagatac
gactcctcgggctacgcagaccagttctctcggaactttgaccaccgcgtgcgctacgag
gagcgcgtccctgcctacgaggagcactggtcctactacgaagacaagcagccctaccag
cctcggcctccttttgagaatcagcactctcgagacctggactccaggcagcatcctgaa
gagtcctcagaacgagggtacttcccacggttcgaggagccagcccctctgtcctatgac
agcagagcccgctatgaccagccacccaggccctccacgctgcgacatgaagagccgccg
gctcctggatatgacgtgcatggtagatacaggcccgaggcacagccctactcctcaggc
ccgaaggcagctgagcccaagcagtattacgaccagtacccacgaggttatgagcaagtc
ccatcgcagggcttcccctcgaaagcaggcccttacgagcctctgcacggtgctgcggcg
gcccccctgcaggtgcctgcggctcagcacaagccggaaccccctcccgccagcaccaag
ccgctgcccccgcccccagctccagctgaggaagaggaggaccctgccatgaagccgcag
tccgtgctcacgagggtgaagatgtttgagaacaaaaggtctgcgtccttggagagcaaa
aaagaggaaaaccacaccactggcttcaagcccccggaggtagcagctaaaccttcaggc
gctcccatcgtcggtcccaaagctcctcctcagagtcaattcagtgaccacgacaagaca
ctgtacaggatcccagaacctcagaaacctcagccgaagccccctgaagatatcgtccgg
tcaaatcattatgaccctgaggaagatgaagaatattaccggaaacagctctcctacttc
gaccgaaggagttttgagaacaagcctcctgcccacatccctgccggccacctcccggag
ccggccaagcccgttcactcccagcatcagccgagcctgtctagttacgcttcgaagggc
aagtctgcggacactgacgctgtggagagagcgttcgagaagcgctacgacccggggcag
cctgcgcccggccccgcgctccacgcccacgcccacgcccacgccaaaggagcccacggg
gaaggtaattcagtgtcattggattttcagaattctttagtatccaaaccagagccgcct
ccatctcaaaataaaccaacaactttcagaccaatgaaccgagaggatcccgctcagtcc
accttctacgcccagaaaagtttcacagataaagctcctgtgaacgggaccgaacagact
caaaaaacagtcgccccagcctacaatcggttcacccccaaaccatacaccagttctgcg
cggccctttgagcgcaagtttgaaagccctaaattcagtcacaacctcctgccaagcgaa
tccgcgcacaagcccgacgtgtcttcaaaggtccccacgtctcccaaaaccctcatgaaa
gcacagcctcccgagttcgacagcggagtggagacgttctccgtccacgcagacaagcct
aggtaccaggcgaacagcgtcagcgccgtgcccaaggctgtccccgtgagccccacagct
gtgccggacgagggcgacggtgaggatggccacaccgtggtggccacggcccgcggcgtg
ttcaacggcaacggcggggtgctgagctccatagagacgggcgtcagcatcatcatcccg
cagggcgccatccccgagggcatggagcaggagatctacttcaaggtctgcagggataac
agcatcctgccgccgctggacaaggagaagggagagaccctgctgagcccgttagtgatg
tgcgggccccatggcctcaagttcctgaagcccgtggagctgcgcctgccacactgtgcg
tccatgactcctgacggttggtcttttgctctaaaatcatccgactcctcgtcgggtgat
cctaaaacctggcaaaacaagtgtcttcctggagatcccaattaccttgtgggagccaac
tgcgtttctgtcctgatcgaccacttttaa

DBGET integrated database retrieval system